id	sid	tid	token	lemma	pos
cord-266230-ia04jc9j	1	1	key	key	NN
cord-266230-ia04jc9j	1	2	:	:	:
cord-266230-ia04jc9j	1	3	cord-266230-ia04jc9j	cord-266230-ia04jc9j	NNP
cord-266230-ia04jc9j	1	4	authors	author	NNS
cord-266230-ia04jc9j	1	5	:	:	:
cord-266230-ia04jc9j	1	6	Rott	Rott	NNP
cord-266230-ia04jc9j	1	7	,	,	,
cord-266230-ia04jc9j	1	8	M.	M.	NNP
cord-266230-ia04jc9j	1	9	E.	E.	NNP
cord-266230-ia04jc9j	1	10	;	;	:
cord-266230-ia04jc9j	2	1	Tremaine	Tremaine	NNP
cord-266230-ia04jc9j	2	2	,	,	,
cord-266230-ia04jc9j	2	3	J.	J.	NNP
cord-266230-ia04jc9j	2	4	H.	H.	NNP
cord-266230-ia04jc9j	2	5	;	;	:
cord-266230-ia04jc9j	2	6	Rochon	Rochon	NNP
cord-266230-ia04jc9j	2	7	,	,	,
cord-266230-ia04jc9j	2	8	D.	D.	NNP
cord-266230-ia04jc9j	2	9	M.	M.	NNP
cord-266230-ia04jc9j	2	10	title	title	NN
cord-266230-ia04jc9j	2	11	:	:	:
cord-266230-ia04jc9j	2	12	Comparison	comparison	NN
cord-266230-ia04jc9j	2	13	of	of	IN
cord-266230-ia04jc9j	2	14	the	the	DT
cord-266230-ia04jc9j	2	15	5′	5′	CD
cord-266230-ia04jc9j	2	16	and	and	CC
cord-266230-ia04jc9j	2	17	3′	3′	CD
cord-266230-ia04jc9j	2	18	termini	terminus	NNS
cord-266230-ia04jc9j	2	19	of	of	IN
cord-266230-ia04jc9j	2	20	tomato	tomato	NN
cord-266230-ia04jc9j	2	21	ringspot	ringspot	NN
cord-266230-ia04jc9j	2	22	virus	virus	NN
cord-266230-ia04jc9j	2	23	RNA1	RNA1	NNP
cord-266230-ia04jc9j	2	24	and	and	CC
cord-266230-ia04jc9j	2	25	RNA2	RNA2	NNP
cord-266230-ia04jc9j	2	26	:	:	:
cord-266230-ia04jc9j	3	1	Evidence	evidence	NN
cord-266230-ia04jc9j	3	2	for	for	IN
cord-266230-ia04jc9j	3	3	RNA	rna	NN
cord-266230-ia04jc9j	3	4	recombination	recombination	NN
cord-266230-ia04jc9j	3	5	date	date	NN
cord-266230-ia04jc9j	3	6	:	:	:
cord-266230-ia04jc9j	3	7	1991	1991	CD
cord-266230-ia04jc9j	3	8	-	-	SYM
cord-266230-ia04jc9j	3	9	11	11	CD
cord-266230-ia04jc9j	3	10	-	-	SYM
cord-266230-ia04jc9j	3	11	30	30	CD
cord-266230-ia04jc9j	3	12	journal	journal	NN
cord-266230-ia04jc9j	3	13	:	:	:
cord-266230-ia04jc9j	4	1	Virology	virology	NN
cord-266230-ia04jc9j	4	2	DOI	DOI	NNP
cord-266230-ia04jc9j	4	3	:	:	:
cord-266230-ia04jc9j	4	4	10.1016/0042	10.1016/0042	CD
cord-266230-ia04jc9j	4	5	-	-	HYPH
cord-266230-ia04jc9j	4	6	6822(91)90801-h	6822(91)90801-h	CD
cord-266230-ia04jc9j	4	7	sha	sha	NNP
cord-266230-ia04jc9j	4	8	:	:	:
cord-266230-ia04jc9j	5	1	d9c6fb395b7a9f5e8aa2ef5b99d75c1a57bcb223	d9c6fb395b7a9f5e8aa2ef5b99d75c1a57bcb223	NNP
cord-266230-ia04jc9j	5	2	doc_id	doc_id	NNP
cord-266230-ia04jc9j	5	3	:	:	:
cord-266230-ia04jc9j	6	1	266230	266230	CD
cord-266230-ia04jc9j	6	2	cord_uid	cord_uid	NNS
cord-266230-ia04jc9j	6	3	:	:	:
cord-266230-ia04jc9j	7	1	ia04jc9j	ia04jc9j	RB
cord-266230-ia04jc9j	8	1	Abstract	Abstract	NNP
cord-266230-ia04jc9j	9	1	The	the	DT
cord-266230-ia04jc9j	9	2	sequences	sequence	NNS
cord-266230-ia04jc9j	9	3	of	of	IN
cord-266230-ia04jc9j	9	4	the	the	DT
cord-266230-ia04jc9j	9	5	5′	5′	CD
cord-266230-ia04jc9j	9	6	terminal	terminal	NN
cord-266230-ia04jc9j	9	7	1140	1140	CD
cord-266230-ia04jc9j	9	8	and	and	CC
cord-266230-ia04jc9j	9	9	3′	3′	CD
cord-266230-ia04jc9j	9	10	terminal	terminal	NN
cord-266230-ia04jc9j	9	11	1546	1546	CD
cord-266230-ia04jc9j	9	12	nt	nt	RB
cord-266230-ia04jc9j	9	13	of	of	IN
cord-266230-ia04jc9j	9	14	tomato	tomato	NN
cord-266230-ia04jc9j	9	15	ringspot	ringspot	NN
cord-266230-ia04jc9j	9	16	virus	virus	NN
cord-266230-ia04jc9j	9	17	(	(	-LRB-
cord-266230-ia04jc9j	9	18	TomRSV	TomRSV	NNP
cord-266230-ia04jc9j	9	19	)	)	-RRB-
cord-266230-ia04jc9j	9	20	RNA1	RNA1	NNP
cord-266230-ia04jc9j	9	21	have	have	VBP
cord-266230-ia04jc9j	9	22	been	be	VBN
cord-266230-ia04jc9j	9	23	determined	determine	VBN
cord-266230-ia04jc9j	9	24	.	.	.
cord-266230-ia04jc9j	10	1	These	these	DT
cord-266230-ia04jc9j	10	2	sequences	sequence	NNS
cord-266230-ia04jc9j	10	3	share	share	VBP
cord-266230-ia04jc9j	10	4	a	a	DT
cord-266230-ia04jc9j	10	5	high	high	JJ
cord-266230-ia04jc9j	10	6	degree	degree	NN
cord-266230-ia04jc9j	10	7	of	of	IN
cord-266230-ia04jc9j	10	8	nucleotide	nucleotide	JJ
cord-266230-ia04jc9j	10	9	sequence	sequence	NN
cord-266230-ia04jc9j	10	10	similarity	similarity	NN
cord-266230-ia04jc9j	10	11	with	with	IN
cord-266230-ia04jc9j	10	12	the	the	DT
cord-266230-ia04jc9j	10	13	previously	previously	RB
cord-266230-ia04jc9j	10	14	determined	determine	VBN
cord-266230-ia04jc9j	10	15	TomRSV	TomRSV	NNP
cord-266230-ia04jc9j	10	16	RNA2	RNA2	NNP
cord-266230-ia04jc9j	10	17	sequence	sequence	NN
cord-266230-ia04jc9j	10	18	.	.	.
cord-266230-ia04jc9j	11	1	Eighty	eighty	CD
cord-266230-ia04jc9j	11	2	-	-	HYPH
cord-266230-ia04jc9j	11	3	eight	eight	CD
cord-266230-ia04jc9j	11	4	percent	percent	NN
cord-266230-ia04jc9j	11	5	of	of	IN
cord-266230-ia04jc9j	11	6	the	the	DT
cord-266230-ia04jc9j	11	7	5	5	CD
cord-266230-ia04jc9j	11	8	'	'	''
cord-266230-ia04jc9j	11	9	terminal	terminal	NN
cord-266230-ia04jc9j	11	10	907	907	CD
cord-266230-ia04jc9j	11	11	nt	nt	RB
cord-266230-ia04jc9j	11	12	of	of	IN
cord-266230-ia04jc9j	11	13	TomRSV	TomRSV	NNP
cord-266230-ia04jc9j	11	14	RNA1	RNA1	NNP
cord-266230-ia04jc9j	11	15	and	and	CC
cord-266230-ia04jc9j	11	16	RNA2	RNA2	NNP
cord-266230-ia04jc9j	11	17	contain	contain	VBP
cord-266230-ia04jc9j	11	18	identical	identical	JJ
cord-266230-ia04jc9j	11	19	nucleotide	nucleotide	JJ
cord-266230-ia04jc9j	11	20	residues	residue	NNS
cord-266230-ia04jc9j	11	21	;	;	:
cord-266230-ia04jc9j	11	22	the	the	DT
cord-266230-ia04jc9j	11	23	first	first	JJ
cord-266230-ia04jc9j	11	24	459	459	CD
cord-266230-ia04jc9j	11	25	nt	nt	RB
cord-266230-ia04jc9j	11	26	are	be	VBP
cord-266230-ia04jc9j	11	27	identical	identical	JJ
cord-266230-ia04jc9j	11	28	at	at	IN
cord-266230-ia04jc9j	11	29	all	all	DT
cord-266230-ia04jc9j	11	30	positions	position	NNS
cord-266230-ia04jc9j	11	31	,	,	,
cord-266230-ia04jc9j	11	32	whereas	whereas	IN
cord-266230-ia04jc9j	11	33	the	the	DT
cord-266230-ia04jc9j	11	34	next	next	JJ
cord-266230-ia04jc9j	11	35	447	447	CD
cord-266230-ia04jc9j	11	36	nt	nt	NNS
cord-266230-ia04jc9j	11	37	are	be	VBP
cord-266230-ia04jc9j	11	38	identical	identical	JJ
cord-266230-ia04jc9j	11	39	at	at	IN
cord-266230-ia04jc9j	11	40	only	only	RB
cord-266230-ia04jc9j	11	41	75.8	75.8	CD
cord-266230-ia04jc9j	11	42	%	%	NN
cord-266230-ia04jc9j	11	43	of	of	IN
cord-266230-ia04jc9j	11	44	the	the	DT
cord-266230-ia04jc9j	11	45	nucleotide	nucleotide	JJ
cord-266230-ia04jc9j	11	46	positions	position	NNS
cord-266230-ia04jc9j	11	47	.	.	.
cord-266230-ia04jc9j	12	1	The	the	DT
cord-266230-ia04jc9j	12	2	region	region	NN
cord-266230-ia04jc9j	12	3	of	of	IN
cord-266230-ia04jc9j	12	4	similarity	similarity	NN
cord-266230-ia04jc9j	12	5	includes	include	VBZ
cord-266230-ia04jc9j	12	6	not	not	RB
cord-266230-ia04jc9j	12	7	only	only	RB
cord-266230-ia04jc9j	12	8	the	the	DT
cord-266230-ia04jc9j	12	9	5	5	CD
cord-266230-ia04jc9j	12	10	'	'	POS
cord-266230-ia04jc9j	12	11	nontranslated	nontranslated	JJ
cord-266230-ia04jc9j	12	12	leader	leader	NN
cord-266230-ia04jc9j	12	13	but	but	CC
cord-266230-ia04jc9j	12	14	also	also	RB
cord-266230-ia04jc9j	12	15	sequence	sequence	VBP
cord-266230-ia04jc9j	12	16	probably	probably	RB
cord-266230-ia04jc9j	12	17	encoding	encode	VBG
cord-266230-ia04jc9j	12	18	polyproteins	polyprotein	NNS
cord-266230-ia04jc9j	12	19	.	.	.
cord-266230-ia04jc9j	13	1	The	the	DT
cord-266230-ia04jc9j	13	2	3′	3′	CD
cord-266230-ia04jc9j	13	3	terminal	terminal	NN
cord-266230-ia04jc9j	13	4	1533	1533	CD
cord-266230-ia04jc9j	13	5	nt	nt	RB
cord-266230-ia04jc9j	13	6	of	of	IN
cord-266230-ia04jc9j	13	7	TomRSV	TomRSV	NNP
cord-266230-ia04jc9j	13	8	RNA1	RNA1	NNP
cord-266230-ia04jc9j	13	9	and	and	CC
cord-266230-ia04jc9j	13	10	RNA2	RNA2	NNP
cord-266230-ia04jc9j	13	11	are	be	VBP
cord-266230-ia04jc9j	13	12	identical	identical	JJ
cord-266230-ia04jc9j	13	13	and	and	CC
cord-266230-ia04jc9j	13	14	are	be	VBP
cord-266230-ia04jc9j	13	15	noncoding	noncoding	JJ
cord-266230-ia04jc9j	13	16	.	.	.
cord-266230-ia04jc9j	14	1	The	the	DT
cord-266230-ia04jc9j	14	2	sequences	sequence	NNS
cord-266230-ia04jc9j	14	3	common	common	JJ
cord-266230-ia04jc9j	14	4	to	to	IN
cord-266230-ia04jc9j	14	5	RNA1	RNA1	NNP
cord-266230-ia04jc9j	14	6	and	and	CC
cord-266230-ia04jc9j	14	7	RNA2	RNA2	NNP
cord-266230-ia04jc9j	14	8	account	account	NN
cord-266230-ia04jc9j	14	9	for	for	IN
cord-266230-ia04jc9j	14	10	almost	almost	RB
cord-266230-ia04jc9j	14	11	35	35	CD
cord-266230-ia04jc9j	14	12	%	%	NN
cord-266230-ia04jc9j	14	13	of	of	IN
cord-266230-ia04jc9j	14	14	the	the	DT
cord-266230-ia04jc9j	14	15	total	total	JJ
cord-266230-ia04jc9j	14	16	genomic	genomic	JJ
cord-266230-ia04jc9j	14	17	sequence	sequence	NN
cord-266230-ia04jc9j	14	18	.	.	.
cord-266230-ia04jc9j	15	1	It	-PRON-	PRP
cord-266230-ia04jc9j	15	2	is	be	VBZ
cord-266230-ia04jc9j	15	3	possible	possible	JJ
cord-266230-ia04jc9j	15	4	that	that	IN
cord-266230-ia04jc9j	15	5	the	the	DT
cord-266230-ia04jc9j	15	6	similar	similar	JJ
cord-266230-ia04jc9j	15	7	sequences	sequence	NNS
cord-266230-ia04jc9j	15	8	at	at	IN
cord-266230-ia04jc9j	15	9	both	both	DT
cord-266230-ia04jc9j	15	10	ends	end	NNS
cord-266230-ia04jc9j	15	11	of	of	IN
cord-266230-ia04jc9j	15	12	TomRSV	TomRSV	NNP
cord-266230-ia04jc9j	15	13	RNA1	RNA1	NNP
cord-266230-ia04jc9j	15	14	and	and	CC
cord-266230-ia04jc9j	15	15	RNA2	RNA2	NNP
cord-266230-ia04jc9j	15	16	are	be	VBP
cord-266230-ia04jc9j	15	17	a	a	DT
cord-266230-ia04jc9j	15	18	result	result	NN
cord-266230-ia04jc9j	15	19	of	of	IN
cord-266230-ia04jc9j	15	20	recombination	recombination	NN
cord-266230-ia04jc9j	15	21	between	between	IN
cord-266230-ia04jc9j	15	22	these	these	DT
cord-266230-ia04jc9j	15	23	two	two	CD
cord-266230-ia04jc9j	15	24	genomic	genomic	JJ
cord-266230-ia04jc9j	15	25	RNA	rna	NN
cord-266230-ia04jc9j	15	26	components	component	NNS
cord-266230-ia04jc9j	15	27	.	.	.
cord-266230-ia04jc9j	16	1	o	o	UH
cord-266230-ia04jc9j	16	2	1991	1991	CD
cord-266230-ia04jc9j	16	3	Academic	Academic	NNP
cord-266230-ia04jc9j	16	4	press	press	NN
cord-266230-ia04jc9j	16	5	.	.	.
cord-266230-ia04jc9j	17	1	inc	inc	NNP
cord-266230-ia04jc9j	17	2	.	.	.
cord-266230-ia04jc9j	18	1	involving	involve	VBG
cord-266230-ia04jc9j	18	2	the	the	DT
cord-266230-ia04jc9j	18	3	exchange	exchange	NN
cord-266230-ia04jc9j	18	4	of	of	IN
cord-266230-ia04jc9j	18	5	genetic	genetic	JJ
cord-266230-ia04jc9j	18	6	information	information	NN
cord-266230-ia04jc9j	18	7	between	between	IN
cord-266230-ia04jc9j	18	8	genomic	genomic	JJ
cord-266230-ia04jc9j	18	9	RNA	RNA	NNP
cord-266230-ia04jc9j	18	10	molecules	molecule	NNS
cord-266230-ia04jc9j	18	11	of	of	IN
cord-266230-ia04jc9j	18	12	RNA	RNA	NNP
cord-266230-ia04jc9j	18	13	viruses	virus	NNS
cord-266230-ia04jc9j	18	14	,	,	,
cord-266230-ia04jc9j	18	15	appears	appear	VBZ
cord-266230-ia04jc9j	18	16	to	to	TO
cord-266230-ia04jc9j	18	17	play	play	VB
cord-266230-ia04jc9j	18	18	a	a	DT
cord-266230-ia04jc9j	18	19	number	number	NN
cord-266230-ia04jc9j	18	20	of	of	IN
cord-266230-ia04jc9j	18	21	important	important	JJ
cord-266230-ia04jc9j	18	22	functions	function	NNS
cord-266230-ia04jc9j	18	23	during	during	IN
cord-266230-ia04jc9j	18	24	the	the	DT
cord-266230-ia04jc9j	18	25	evolution	evolution	NN
cord-266230-ia04jc9j	18	26	and	and	CC
cord-266230-ia04jc9j	18	27	life	life	NN
cord-266230-ia04jc9j	18	28	cycle	cycle	NN
cord-266230-ia04jc9j	18	29	of	of	IN
cord-266230-ia04jc9j	18	30	RNA	RNA	NNP
cord-266230-ia04jc9j	18	31	viruses	virus	NNS
cord-266230-ia04jc9j	18	32	(	(	-LRB-
cord-266230-ia04jc9j	18	33	for	for	IN
cord-266230-ia04jc9j	18	34	reviews	review	NNS
cord-266230-ia04jc9j	18	35	see	see	VBP
cord-266230-ia04jc9j	18	36	7	7	CD
cord-266230-ia04jc9j	18	37	,	,	,
cord-266230-ia04jc9j	18	38	2	2	CD
cord-266230-ia04jc9j	18	39	)	)	-RRB-
cord-266230-ia04jc9j	18	40	.	.	.
cord-266230-ia04jc9j	19	1	The	the	DT
cord-266230-ia04jc9j	19	2	importance	importance	NN
cord-266230-ia04jc9j	19	3	of	of	IN
cord-266230-ia04jc9j	19	4	nonhomologous	nonhomologous	NNP
cord-266230-ia04jc9j	19	5	RNA	RNA	NNP
cord-266230-ia04jc9j	19	6	recombination	recombination	NN
cord-266230-ia04jc9j	19	7	in	in	IN
cord-266230-ia04jc9j	19	8	the	the	DT
cord-266230-ia04jc9j	19	9	generation	generation	NN
cord-266230-ia04jc9j	19	10	of	of	IN
cord-266230-ia04jc9j	19	11	evolutionary	evolutionary	JJ
cord-266230-ia04jc9j	19	12	diversity	diversity	NN
cord-266230-ia04jc9j	19	13	can	can	MD
cord-266230-ia04jc9j	19	14	be	be	VB
cord-266230-ia04jc9j	19	15	seen	see	VBN
cord-266230-ia04jc9j	19	16	in	in	IN
cord-266230-ia04jc9j	19	17	the	the	DT
cord-266230-ia04jc9j	19	18	modularity	modularity	NN
cord-266230-ia04jc9j	19	19	of	of	IN
cord-266230-ia04jc9j	19	20	viralencoded	viralencoded	JJ
cord-266230-ia04jc9j	19	21	genes	gene	NNS
cord-266230-ia04jc9j	19	22	.	.	.
cord-266230-ia04jc9j	20	1	In	in	IN
cord-266230-ia04jc9j	20	2	addition	addition	NN
cord-266230-ia04jc9j	20	3	,	,	,
cord-266230-ia04jc9j	20	4	many	many	JJ
cord-266230-ia04jc9j	20	5	RNA	RNA	NNP
cord-266230-ia04jc9j	20	6	viruses	virus	NNS
cord-266230-ia04jc9j	20	7	produce	produce	VBP
cord-266230-ia04jc9j	20	8	defective	defective	JJ
cord-266230-ia04jc9j	20	9	-	-	HYPH
cord-266230-ia04jc9j	20	10	interfering	interfere	VBG
cord-266230-ia04jc9j	20	11	RNAs	rna	NNS
cord-266230-ia04jc9j	20	12	which	which	WDT
cord-266230-ia04jc9j	20	13	may	may	MD
cord-266230-ia04jc9j	20	14	be	be	VB
cord-266230-ia04jc9j	20	15	a	a	DT
cord-266230-ia04jc9j	20	16	result	result	NN
cord-266230-ia04jc9j	20	17	of	of	IN
cord-266230-ia04jc9j	20	18	recombination	recombination	NN
cord-266230-ia04jc9j	20	19	.	.	.
cord-266230-ia04jc9j	21	1	Homologous	Homologous	NNP
cord-266230-ia04jc9j	21	2	RNA	RNA	NNP
cord-266230-ia04jc9j	21	3	recombination	recombination	NN
cord-266230-ia04jc9j	21	4	has	have	VBZ
cord-266230-ia04jc9j	21	5	been	be	VBN
cord-266230-ia04jc9j	21	6	observed	observe	VBN
cord-266230-ia04jc9j	21	7	among	among	IN
cord-266230-ia04jc9j	21	8	the	the	DT
cord-266230-ia04jc9j	21	9	picornaviruses	picornavirus	NNS
cord-266230-ia04jc9j	21	10	(	(	-LRB-
cord-266230-ia04jc9j	21	11	3	3	CD
cord-266230-ia04jc9j	21	12	)	)	-RRB-
cord-266230-ia04jc9j	21	13	,	,	,
cord-266230-ia04jc9j	21	14	coronaviruses	coronaviruses	NNP
cord-266230-ia04jc9j	21	15	(	(	-LRB-
cord-266230-ia04jc9j	21	16	4	4	CD
cord-266230-ia04jc9j	21	17	)	)	-RRB-
cord-266230-ia04jc9j	21	18	,	,	,
cord-266230-ia04jc9j	21	19	and	and	CC
cord-266230-ia04jc9j	21	20	bromoviruses	bromoviruses	NNP
cord-266230-ia04jc9j	21	21	(	(	-LRB-
cord-266230-ia04jc9j	21	22	5	5	CD
cord-266230-ia04jc9j	21	23	)	)	-RRB-
cord-266230-ia04jc9j	21	24	and	and	CC
cord-266230-ia04jc9j	21	25	is	be	VBZ
cord-266230-ia04jc9j	21	26	suspected	suspect	VBN
cord-266230-ia04jc9j	21	27	to	to	TO
cord-266230-ia04jc9j	21	28	occur	occur	VB
cord-266230-ia04jc9j	21	29	in	in	IN
cord-266230-ia04jc9j	21	30	the	the	DT
cord-266230-ia04jc9j	21	31	tobraviruses	tobraviruse	NNS
cord-266230-ia04jc9j	21	32	(	(	-LRB-
cord-266230-ia04jc9j	21	33	6	6	CD
cord-266230-ia04jc9j	21	34	)	)	-RRB-
cord-266230-ia04jc9j	21	35	.	.	.
cord-266230-ia04jc9j	22	1	It	-PRON-	PRP
cord-266230-ia04jc9j	22	2	has	have	VBZ
cord-266230-ia04jc9j	22	3	been	be	VBN
cord-266230-ia04jc9j	22	4	suggested	suggest	VBN
cord-266230-ia04jc9j	22	5	that	that	IN
cord-266230-ia04jc9j	22	6	homologous	homologous	JJ
cord-266230-ia04jc9j	22	7	recombination	recombination	NN
cord-266230-ia04jc9j	22	8	in	in	IN
cord-266230-ia04jc9j	22	9	the	the	DT
cord-266230-ia04jc9j	22	10	picornaviruses	picornavirus	NNS
cord-266230-ia04jc9j	22	11	and	and	CC
cord-266230-ia04jc9j	22	12	coronaviruses	coronaviruse	NNS
cord-266230-ia04jc9j	22	13	is	be	VBZ
cord-266230-ia04jc9j	22	14	important	important	JJ
cord-266230-ia04jc9j	22	15	for	for	IN
cord-266230-ia04jc9j	22	16	repairing	repair	VBG
cord-266230-ia04jc9j	22	17	defective	defective	JJ
cord-266230-ia04jc9j	22	18	genomes	genome	NNS
cord-266230-ia04jc9j	22	19	.	.	.
cord-266230-ia04jc9j	23	1	In	in	IN
cord-266230-ia04jc9j	23	2	addition	addition	NN
cord-266230-ia04jc9j	23	3	,	,	,
cord-266230-ia04jc9j	23	4	coronaviruses	coronaviruse	NNS
cord-266230-ia04jc9j	23	5	undergo	undergo	VBP
cord-266230-ia04jc9j	23	6	site	site	NN
cord-266230-ia04jc9j	23	7	-	-	HYPH
cord-266230-ia04jc9j	23	8	specific	specific	JJ
cord-266230-ia04jc9j	23	9	recombination	recombination	NN
cord-266230-ia04jc9j	23	10	to	to	TO
cord-266230-ia04jc9j	23	11	express	express	VB
cord-266230-ia04jc9j	23	12	downstream	downstream	JJ
cord-266230-ia04jc9j	23	13	genes	gene	NNS
cord-266230-ia04jc9j	23	14	from	from	IN
cord-266230-ia04jc9j	23	15	leader	leader	NN
cord-266230-ia04jc9j	23	16	-	-	HYPH
cord-266230-ia04jc9j	23	17	primed	prime	VBN
cord-266230-ia04jc9j	23	18	subgenomic	subgenomic	JJ
cord-266230-ia04jc9j	23	19	transcripts	transcript	NNS
cord-266230-ia04jc9j	23	20	(	(	-LRB-
cord-266230-ia04jc9j	23	21	see	see	VB
cord-266230-ia04jc9j	23	22	7	7	CD
cord-266230-ia04jc9j	23	23	)	)	-RRB-
cord-266230-ia04jc9j	23	24	.	.	.
cord-266230-ia04jc9j	24	1	Tomato	tomato	NN
cord-266230-ia04jc9j	24	2	ringspot	ringspot	NN
cord-266230-ia04jc9j	24	3	virus	virus	NN
cord-266230-ia04jc9j	24	4	(	(	-LRB-
cord-266230-ia04jc9j	24	5	TomRSV	TomRSV	NNP
cord-266230-ia04jc9j	24	6	)	)	-RRB-
cord-266230-ia04jc9j	24	7	is	be	VBZ
cord-266230-ia04jc9j	24	8	a	a	DT
cord-266230-ia04jc9j	24	9	member	member	NN
cord-266230-ia04jc9j	24	10	of	of	IN
cord-266230-ia04jc9j	24	11	the	the	DT
cord-266230-ia04jc9j	24	12	nepovirus	nepovirus	NNP
cord-266230-ia04jc9j	24	13	group	group	NNP
cord-266230-ia04jc9j	24	14	(	(	-LRB-
cord-266230-ia04jc9j	24	15	8)	8)	NNP
cord-266230-ia04jc9j	24	16	.	.	.
cord-266230-ia04jc9j	25	1	Nepoviruses	nepoviruse	NNS
cord-266230-ia04jc9j	25	2	consist	consist	VBP
cord-266230-ia04jc9j	25	3	of	of	IN
cord-266230-ia04jc9j	25	4	28-nm	28-nm	CD
cord-266230-ia04jc9j	25	5	spherical	spherical	JJ
cord-266230-ia04jc9j	25	6	particles	particle	NNS
cord-266230-ia04jc9j	25	7	composed	compose	VBN
cord-266230-ia04jc9j	25	8	of	of	IN
cord-266230-ia04jc9j	25	9	60	60	CD
cord-266230-ia04jc9j	25	10	copies	copy	NNS
cord-266230-ia04jc9j	25	11	of	of	IN
cord-266230-ia04jc9j	25	12	a	a	DT
cord-266230-ia04jc9j	25	13	single	single	JJ
cord-266230-ia04jc9j	25	14	coat	coat	NN
cord-266230-ia04jc9j	25	15	protein	protein	NN
cord-266230-ia04jc9j	25	16	species	specie	NNS
cord-266230-ia04jc9j	25	17	and	and	CC
cord-266230-ia04jc9j	25	18	two	two	CD
cord-266230-ia04jc9j	25	19	separately	separately	RB
cord-266230-ia04jc9j	25	20	encapsidated	encapsidate	VBN
cord-266230-ia04jc9j	25	21	genomic	genomic	JJ
cord-266230-ia04jc9j	25	22	RNAcomponents	rnacomponent	NNS
cord-266230-ia04jc9j	25	23	.	.	.
cord-266230-ia04jc9j	26	1	Nepoviruses	nepoviruse	NNS
cord-266230-ia04jc9j	26	2	share	share	VBP
cord-266230-ia04jc9j	26	3	similarities	similarity	NNS
cord-266230-ia04jc9j	26	4	in	in	IN
cord-266230-ia04jc9j	26	5	genomic	genomic	JJ
cord-266230-ia04jc9j	26	6	structure	structure	NN
cord-266230-ia04jc9j	26	7	and	and	CC
cord-266230-ia04jc9j	26	8	translational	translational	JJ
cord-266230-ia04jc9j	26	9	strategies	strategy	NNS
cord-266230-ia04jc9j	26	10	with	with	IN
cord-266230-ia04jc9j	26	11	the	the	DT
cord-266230-ia04jc9j	26	12	plant	plant	NN
cord-266230-ia04jc9j	26	13	coma	coma	NN
cord-266230-ia04jc9j	26	14	-	-	,
cord-266230-ia04jc9j	26	15	and	and	CC
cord-266230-ia04jc9j	26	16	potyviruses	potyviruse	NNS
cord-266230-ia04jc9j	26	17	as	as	RB
cord-266230-ia04jc9j	26	18	well	well	RB
cord-266230-ia04jc9j	26	19	as	as	IN
cord-266230-ia04jc9j	26	20	the	the	DT
cord-266230-ia04jc9j	26	21	animal	animal	NN
cord-266230-ia04jc9j	26	22	picornaviruses	picornavirus	NNS
cord-266230-ia04jc9j	26	23	(	(	-LRB-
cord-266230-ia04jc9j	26	24	9	9	CD
cord-266230-ia04jc9j	26	25	)	)	-RRB-
cord-266230-ia04jc9j	26	26	.	.	.
cord-266230-ia04jc9j	27	1	Previously	previously	RB
cord-266230-ia04jc9j	27	2	,	,	,
cord-266230-ia04jc9j	27	3	we	-PRON-	PRP
cord-266230-ia04jc9j	27	4	reported	report	VBD
cord-266230-ia04jc9j	27	5	that	that	IN
cord-266230-ia04jc9j	27	6	the	the	DT
cord-266230-ia04jc9j	27	7	3	3	CD
cord-266230-ia04jc9j	27	8	'	'	NN
cord-266230-ia04jc9j	27	9	termini	terminus	NNS
cord-266230-ia04jc9j	27	10	of	of	IN
cord-266230-ia04jc9j	27	11	TomRSV	TomRSV	NNP
cord-266230-ia04jc9j	27	12	RNA1	RNA1	NNP
cord-266230-ia04jc9j	27	13	and	and	CC
cord-266230-ia04jc9j	27	14	RNA2	RNA2	NNP
cord-266230-ia04jc9j	27	15	share	share	VBP
cord-266230-ia04jc9j	27	16	an	an	DT
cord-266230-ia04jc9j	27	17	'	'	``
cord-266230-ia04jc9j	27	18	Sequence	sequence	NN
cord-266230-ia04jc9j	27	19	data	datum	NNS
cord-266230-ia04jc9j	27	20	from	from	IN
cord-266230-ia04jc9j	27	21	this	this	DT
cord-266230-ia04jc9j	27	22	article	article	NN
cord-266230-ia04jc9j	27	23	have	have	VBP
cord-266230-ia04jc9j	27	24	been	be	VBN
cord-266230-ia04jc9j	27	25	deposited	deposit	VBN
cord-266230-ia04jc9j	27	26	with	with	IN
cord-266230-ia04jc9j	27	27	the	the	DT
cord-266230-ia04jc9j	27	28	EMBUGenbank	EMBUGenbank	NNP
cord-266230-ia04jc9j	27	29	Data	Data	NNP
cord-266230-ia04jc9j	27	30	Libraries	Libraries	NNPS
cord-266230-ia04jc9j	27	31	under	under	IN
cord-266230-ia04jc9j	27	32	Accession	Accession	NNP
cord-266230-ia04jc9j	27	33	Numbers	Numbers	NNPS
cord-266230-ia04jc9j	27	34	M27935	M27935	NNP
cord-266230-ia04jc9j	27	35	and	and	CC
cord-266230-ia04jc9j	27	36	M73822	M73822	NNP
cord-266230-ia04jc9j	27	37	.	.	.
cord-266230-ia04jc9j	28	1	2	2	LS
cord-266230-ia04jc9j	29	1	To	to	TO
cord-266230-ia04jc9j	29	2	whom	whom	WP
cord-266230-ia04jc9j	29	3	requests	request	VBZ
cord-266230-ia04jc9j	29	4	for	for	IN
cord-266230-ia04jc9j	29	5	reprints	reprint	NNS
cord-266230-ia04jc9j	29	6	should	should	MD
cord-266230-ia04jc9j	29	7	be	be	VB
cord-266230-ia04jc9j	29	8	addressed	address	VBN
cord-266230-ia04jc9j	29	9	.	.	.
cord-266230-ia04jc9j	30	1	extended	extended	JJ
cord-266230-ia04jc9j	30	2	region	region	NN
cord-266230-ia04jc9j	30	3	of	of	IN
cord-266230-ia04jc9j	30	4	nucleotide	nucleotide	JJ
cord-266230-ia04jc9j	30	5	sequence	sequence	NN
cord-266230-ia04jc9j	30	6	similarity	similarity	NN
cord-266230-ia04jc9j	30	7	,	,	,
cord-266230-ia04jc9j	30	8	as	as	IN
cord-266230-ia04jc9j	30	9	determined	determine	VBN
cord-266230-ia04jc9j	30	10	by	by	IN
cord-266230-ia04jc9j	30	11	restriction	restriction	NN
cord-266230-ia04jc9j	30	12	enzyme	enzyme	NN
cord-266230-ia04jc9j	30	13	cleavage	cleavage	NN
cord-266230-ia04jc9j	30	14	maps	map	NNS
cord-266230-ia04jc9j	30	15	and	and	CC
cord-266230-ia04jc9j	30	16	hybridization	hybridization	NN
cord-266230-ia04jc9j	30	17	analysis	analysis	NN
cord-266230-ia04jc9j	30	18	(	(	-LRB-
cord-266230-ia04jc9j	30	19	10	10	CD
cord-266230-ia04jc9j	30	20	)	)	-RRB-
cord-266230-ia04jc9j	30	21	.	.	.
cord-266230-ia04jc9j	31	1	We	-PRON-	PRP
cord-266230-ia04jc9j	31	2	report	report	VBP
cord-266230-ia04jc9j	31	3	that	that	IN
cord-266230-ia04jc9j	31	4	extensive	extensive	JJ
cord-266230-ia04jc9j	31	5	nucleotide	nucleotide	JJ
cord-266230-ia04jc9j	31	6	sequence	sequence	NN
cord-266230-ia04jc9j	31	7	similarity	similarity	NN
cord-266230-ia04jc9j	31	8	also	also	RB
cord-266230-ia04jc9j	31	9	exists	exist	VBZ
cord-266230-ia04jc9j	31	10	between	between	IN
cord-266230-ia04jc9j	31	11	the	the	DT
cord-266230-ia04jc9j	31	12	5'termini	5'termini	CD
cord-266230-ia04jc9j	31	13	of	of	IN
cord-266230-ia04jc9j	31	14	RNA1	RNA1	NNP
cord-266230-ia04jc9j	31	15	and	and	CC
cord-266230-ia04jc9j	31	16	RNA2	RNA2	NNP
cord-266230-ia04jc9j	31	17	.	.	.
cord-266230-ia04jc9j	32	1	The	the	DT
cord-266230-ia04jc9j	32	2	possibility	possibility	NN
cord-266230-ia04jc9j	32	3	that	that	IN
cord-266230-ia04jc9j	32	4	these	these	DT
cord-266230-ia04jc9j	32	5	repeated	repeat	VBN
cord-266230-ia04jc9j	32	6	sequences	sequence	NNS
cord-266230-ia04jc9j	32	7	may	may	MD
cord-266230-ia04jc9j	32	8	facilitate	facilitate	VB
cord-266230-ia04jc9j	32	9	replication	replication	NN
cord-266230-ia04jc9j	32	10	of	of	IN
cord-266230-ia04jc9j	32	11	TomRSV	TomRSV	NNP
cord-266230-ia04jc9j	32	12	RNA	RNA	NNP
cord-266230-ia04jc9j	32	13	,	,	,
cord-266230-ia04jc9j	32	14	perhaps	perhaps	RB
cord-266230-ia04jc9j	32	15	through	through	IN
cord-266230-ia04jc9j	32	16	recombination	recombination	NN
cord-266230-ia04jc9j	32	17	,	,	,
cord-266230-ia04jc9j	32	18	will	will	MD
cord-266230-ia04jc9j	32	19	be	be	VB
cord-266230-ia04jc9j	32	20	discussed	discuss	VBN
cord-266230-ia04jc9j	32	21	.	.	.
cord-266230-ia04jc9j	33	1	Two	two	CD
cord-266230-ia04jc9j	33	2	cDNA	cdna	NN
cord-266230-ia04jc9j	33	3	clones	clone	NNS
cord-266230-ia04jc9j	33	4	derived	derive	VBN
cord-266230-ia04jc9j	33	5	from	from	IN
cord-266230-ia04jc9j	33	6	TomRSV	TomRSV	NNP
cord-266230-ia04jc9j	33	7	RNA1	RNA1	NNP
cord-266230-ia04jc9j	33	8	(	(	-LRB-
cord-266230-ia04jc9j	33	9	see	see	VB
cord-266230-ia04jc9j	33	10	Fig	Fig	NNP
cord-266230-ia04jc9j	33	11	.	.	.
cord-266230-ia04jc9j	34	1	1	1	LS
cord-266230-ia04jc9j	34	2	)	)	-RRB-
cord-266230-ia04jc9j	34	3	were	be	VBD
cord-266230-ia04jc9j	34	4	used	use	VBN
cord-266230-ia04jc9j	34	5	to	to	TO
cord-266230-ia04jc9j	34	6	determine	determine	VB
cord-266230-ia04jc9j	34	7	the	the	DT
cord-266230-ia04jc9j	34	8	5	5	CD
cord-266230-ia04jc9j	34	9	'	'	''
cord-266230-ia04jc9j	34	10	and	and	CC
cord-266230-ia04jc9j	34	11	3	3	CD
cord-266230-ia04jc9j	34	12	'	'	POS
cord-266230-ia04jc9j	34	13	terminal	terminal	JJ
cord-266230-ia04jc9j	34	14	sequences	sequence	NNS
cord-266230-ia04jc9j	34	15	of	of	IN
cord-266230-ia04jc9j	34	16	TomRSV	TomRSV	NNP
cord-266230-ia04jc9j	34	17	RNAl	RNAl	NNS
cord-266230-ia04jc9j	34	18	.	.	.
cord-266230-ia04jc9j	35	1	Clone	Clone	NNP
cord-266230-ia04jc9j	35	2	J27	J27	NNP
cord-266230-ia04jc9j	35	3	,	,	,
cord-266230-ia04jc9j	35	4	which	which	WDT
cord-266230-ia04jc9j	35	5	has	have	VBZ
cord-266230-ia04jc9j	35	6	been	be	VBN
cord-266230-ia04jc9j	35	7	previously	previously	RB
cord-266230-ia04jc9j	35	8	described	describe	VBN
cord-266230-ia04jc9j	35	9	(	(	-LRB-
cord-266230-ia04jc9j	35	10	IO	IO	NNP
cord-266230-ia04jc9j	35	11	)	)	-RRB-
cord-266230-ia04jc9j	35	12	,	,	,
cord-266230-ia04jc9j	35	13	was	be	VBD
cord-266230-ia04jc9j	35	14	used	use	VBN
cord-266230-ia04jc9j	35	15	to	to	TO
cord-266230-ia04jc9j	35	16	sequence	sequence	VB
cord-266230-ia04jc9j	35	17	the	the	DT
cord-266230-ia04jc9j	35	18	3	3	CD
cord-266230-ia04jc9j	35	19	'	'	''
cord-266230-ia04jc9j	35	20	terminal	terminal	NN
cord-266230-ia04jc9j	35	21	1546	1546	CD
cord-266230-ia04jc9j	35	22	nt	nt	RB
cord-266230-ia04jc9j	35	23	of	of	IN
cord-266230-ia04jc9j	35	24	TomRSV	TomRSV	NNP
cord-266230-ia04jc9j	35	25	RNA1	RNA1	NNP
cord-266230-ia04jc9j	35	26	and	and	CC
cord-266230-ia04jc9j	35	27	clone	clone	NN
cord-266230-ia04jc9j	35	28	25P6	25p6	CD
cord-266230-ia04jc9j	35	29	was	be	VBD
cord-266230-ia04jc9j	35	30	used	use	VBN
cord-266230-ia04jc9j	35	31	to	to	TO
cord-266230-ia04jc9j	35	32	sequence	sequence	VB
cord-266230-ia04jc9j	35	33	the	the	DT
cord-266230-ia04jc9j	35	34	5	5	CD
cord-266230-ia04jc9j	35	35	'	'	POS
cord-266230-ia04jc9j	35	36	terminal	terminal	JJ
cord-266230-ia04jc9j	35	37	1108	1108	CD
cord-266230-ia04jc9j	35	38	nt	nt	RB
cord-266230-ia04jc9j	35	39	.	.	.
cord-266230-ia04jc9j	36	1	25P6	25p6	CD
cord-266230-ia04jc9j	36	2	was	be	VBD
cord-266230-ia04jc9j	36	3	obtained	obtain	VBN
cord-266230-ia04jc9j	36	4	in	in	IN
cord-266230-ia04jc9j	36	5	essentially	essentially	RB
cord-266230-ia04jc9j	36	6	the	the	DT
cord-266230-ia04jc9j	36	7	same	same	JJ
cord-266230-ia04jc9j	36	8	manner	manner	NN
cord-266230-ia04jc9j	36	9	as	as	IN
cord-266230-ia04jc9j	36	10	J27	J27	NNP
cord-266230-ia04jc9j	36	11	except	except	IN
cord-266230-ia04jc9j	36	12	that	that	DT
cord-266230-ia04jc9j	36	13	random	random	JJ
cord-266230-ia04jc9j	36	14	priming	priming	NN
cord-266230-ia04jc9j	36	15	was	be	VBD
cord-266230-ia04jc9j	36	16	used	use	VBN
cord-266230-ia04jc9j	36	17	for	for	IN
cord-266230-ia04jc9j	36	18	firststrand	firststrand	NNP
cord-266230-ia04jc9j	36	19	cDNA	cDNA	NNP
cord-266230-ia04jc9j	36	20	synthesis	synthesis	NN
cord-266230-ia04jc9j	36	21	.	.	.
cord-266230-ia04jc9j	37	1	Subcloning	subcloning	NN
cord-266230-ia04jc9j	37	2	,	,	,
cord-266230-ia04jc9j	37	3	sequencing	sequencing	NN
cord-266230-ia04jc9j	37	4	,	,	,
cord-266230-ia04jc9j	37	5	sequence	sequence	NN
cord-266230-ia04jc9j	37	6	assembly	assembly	NN
cord-266230-ia04jc9j	37	7	,	,	,
cord-266230-ia04jc9j	37	8	and	and	CC
cord-266230-ia04jc9j	37	9	analysis	analysis	NN
cord-266230-ia04jc9j	37	10	were	be	VBD
cord-266230-ia04jc9j	37	11	essentially	essentially	RB
cord-266230-ia04jc9j	37	12	as	as	IN
cord-266230-ia04jc9j	37	13	described	describe	VBN
cord-266230-ia04jc9j	37	14	previously	previously	RB
cord-266230-ia04jc9j	37	15	(	(	-LRB-
cord-266230-ia04jc9j	37	16	1	1	CD
cord-266230-ia04jc9j	37	17	I	i	NN
cord-266230-ia04jc9j	37	18	)	)	-RRB-
cord-266230-ia04jc9j	37	19	.	.	.
cord-266230-ia04jc9j	38	1	Clone	clone	NN
cord-266230-ia04jc9j	38	2	25P6	25p6	CD
cord-266230-ia04jc9j	38	3	was	be	VBD
cord-266230-ia04jc9j	38	4	found	find	VBN
cord-266230-ia04jc9j	38	5	to	to	TO
cord-266230-ia04jc9j	38	6	hybridize	hybridize	VB
cord-266230-ia04jc9j	38	7	to	to	IN
cord-266230-ia04jc9j	38	8	both	both	DT
cord-266230-ia04jc9j	38	9	TomRSV	TomRSV	NNP
cord-266230-ia04jc9j	38	10	RNA1	RNA1	NNP
cord-266230-ia04jc9j	38	11	and	and	CC
cord-266230-ia04jc9j	38	12	RNA2	RNA2	NNP
cord-266230-ia04jc9j	38	13	in	in	IN
cord-266230-ia04jc9j	38	14	Northern	northern	JJ
cord-266230-ia04jc9j	38	15	hybridization	hybridization	NN
cord-266230-ia04jc9j	38	16	studies	study	NNS
cord-266230-ia04jc9j	38	17	(	(	-LRB-
cord-266230-ia04jc9j	38	18	12	12	CD
cord-266230-ia04jc9j	38	19	)	)	-RRB-
cord-266230-ia04jc9j	38	20	(	(	-LRB-
cord-266230-ia04jc9j	38	21	data	datum	NNS
cord-266230-ia04jc9j	38	22	not	not	RB
cord-266230-ia04jc9j	38	23	shown	show	VBN
cord-266230-ia04jc9j	38	24	)	)	-RRB-
cord-266230-ia04jc9j	38	25	.	.	.
cord-266230-ia04jc9j	39	1	However	however	RB
cord-266230-ia04jc9j	39	2	,	,	,
cord-266230-ia04jc9j	39	3	the	the	DT
cord-266230-ia04jc9j	39	4	restriction	restriction	NN
cord-266230-ia04jc9j	39	5	enzyme	enzyme	NN
cord-266230-ia04jc9j	39	6	map	map	NN
cord-266230-ia04jc9j	39	7	of	of	IN
cord-266230-ia04jc9j	39	8	25P6	25p6	CD
cord-266230-ia04jc9j	39	9	matched	match	VBN
cord-266230-ia04jc9j	39	10	that	that	DT
cord-266230-ia04jc9j	39	11	of	of	IN
cord-266230-ia04jc9j	39	12	the	the	DT
cord-266230-ia04jc9j	39	13	RNA1	RNA1	NNP
cord-266230-ia04jc9j	39	14	-specific	-specific	NN
cord-266230-ia04jc9j	39	15	clone	clone	NN
cord-266230-ia04jc9j	39	16	B54	B54	NNP
cord-266230-ia04jc9j	39	17	(	(	-LRB-
cord-266230-ia04jc9j	39	18	10	10	CD
cord-266230-ia04jc9j	39	19	)	)	-RRB-
cord-266230-ia04jc9j	40	1	(	(	-LRB-
cord-266230-ia04jc9j	40	2	Fig	Fig	NNP
cord-266230-ia04jc9j	40	3	.	.	.
cord-266230-ia04jc9j	41	1	1	1	LS
cord-266230-ia04jc9j	41	2	)	)	-RRB-
cord-266230-ia04jc9j	41	3	but	but	CC
cord-266230-ia04jc9j	41	4	was	be	VBD
cord-266230-ia04jc9j	41	5	distinct	distinct	JJ
cord-266230-ia04jc9j	41	6	from	from	IN
cord-266230-ia04jc9j	41	7	that	that	DT
cord-266230-ia04jc9j	41	8	of	of	IN
cord-266230-ia04jc9j	41	9	the	the	DT
cord-266230-ia04jc9j	41	10	RNA2-specific	RNA2-specific	NNP
cord-266230-ia04jc9j	41	11	clone	clone	NN
cord-266230-ia04jc9j	41	12	035	035	CD
cord-266230-ia04jc9j	41	13	(	(	-LRB-
cord-266230-ia04jc9j	41	14	see	see	VB
cord-266230-ia04jc9j	41	15	7	7	CD
cord-266230-ia04jc9j	41	16	7	7	CD
cord-266230-ia04jc9j	41	17	)	)	-RRB-
cord-266230-ia04jc9j	41	18	.	.	.
cord-266230-ia04jc9j	42	1	To	to	TO
cord-266230-ia04jc9j	42	2	confirm	confirm	VB
cord-266230-ia04jc9j	42	3	that	that	IN
cord-266230-ia04jc9j	42	4	25P6	25p6	CD
cord-266230-ia04jc9j	42	5	was	be	VBD
cord-266230-ia04jc9j	42	6	derived	derive	VBN
cord-266230-ia04jc9j	42	7	from	from	IN
cord-266230-ia04jc9j	42	8	RNAl	RNAl	NNS
cord-266230-ia04jc9j	42	9	,	,	,
cord-266230-ia04jc9j	42	10	the	the	DT
cord-266230-ia04jc9j	42	11	region	region	NN
cord-266230-ia04jc9j	42	12	5	5	CD
cord-266230-ia04jc9j	42	13	'	'	''
cord-266230-ia04jc9j	42	14	to	to	IN
cord-266230-ia04jc9j	42	15	the	the	DT
cord-266230-ia04jc9j	42	16	HindIll	HindIll	NNP
cord-266230-ia04jc9j	42	17	site	site	NN
cord-266230-ia04jc9j	42	18	of	of	IN
cord-266230-ia04jc9j	42	19	B54	B54	NNP
cord-266230-ia04jc9j	42	20	was	be	VBD
cord-266230-ia04jc9j	42	21	partially	partially	RB
cord-266230-ia04jc9j	42	22	sequenced	sequence	VBN
cord-266230-ia04jc9j	42	23	in	in	IN
cord-266230-ia04jc9j	42	24	one	one	CD
cord-266230-ia04jc9j	42	25	direction	direction	NN
cord-266230-ia04jc9j	42	26	and	and	CC
cord-266230-ia04jc9j	42	27	was	be	VBD
cord-266230-ia04jc9j	42	28	found	find	VBN
cord-266230-ia04jc9j	42	29	to	to	TO
cord-266230-ia04jc9j	42	30	be	be	VB
cord-266230-ia04jc9j	42	31	identical	identical	JJ
cord-266230-ia04jc9j	42	32	to	to	IN
cord-266230-ia04jc9j	42	33	the	the	DT
cord-266230-ia04jc9j	42	34	corresponding	correspond	VBG
cord-266230-ia04jc9j	42	35	region	region	NN
cord-266230-ia04jc9j	42	36	obtained	obtain	VBN
cord-266230-ia04jc9j	42	37	from	from	IN
cord-266230-ia04jc9j	42	38	25P6	25p6	CD
cord-266230-ia04jc9j	42	39	(	(	-LRB-
cord-266230-ia04jc9j	42	40	data	datum	NNS
cord-266230-ia04jc9j	42	41	not	not	RB
cord-266230-ia04jc9j	42	42	shown	show	VBN
cord-266230-ia04jc9j	42	43	)	)	-RRB-
cord-266230-ia04jc9j	42	44	.	.	.
cord-266230-ia04jc9j	43	1	The	the	DT
cord-266230-ia04jc9j	43	2	5	5	CD
cord-266230-ia04jc9j	43	3	'	'	POS
cord-266230-ia04jc9j	43	4	terminal	terminal	JJ
cord-266230-ia04jc9j	43	5	sequence	sequence	NN
cord-266230-ia04jc9j	43	6	not	not	RB
cord-266230-ia04jc9j	43	7	encoded	encode	VBN
cord-266230-ia04jc9j	43	8	by	by	IN
cord-266230-ia04jc9j	43	9	25P6	25p6	CD
cord-266230-ia04jc9j	43	10	was	be	VBD
cord-266230-ia04jc9j	43	11	determined	determine	VBN
cord-266230-ia04jc9j	43	12	by	by	IN
cord-266230-ia04jc9j	43	13	dideoxynucleotide	dideoxynucleotide	NN
cord-266230-ia04jc9j	43	14	sequence	sequence	NN
cord-266230-ia04jc9j	43	15	analysis	analysis	NN
cord-266230-ia04jc9j	43	16	using	use	VBG
cord-266230-ia04jc9j	43	17	TomRSV	TomRSV	NNP
cord-266230-ia04jc9j	43	18	RNA	RNA	NNP
cord-266230-ia04jc9j	43	19	as	as	IN
cord-266230-ia04jc9j	43	20	a	a	DT
cord-266230-ia04jc9j	43	21	template	template	NN
cord-266230-ia04jc9j	43	22	and	and	CC
cord-266230-ia04jc9j	43	23	a	a	DT
cord-266230-ia04jc9j	43	24	specific	specific	JJ
cord-266230-ia04jc9j	43	25	oligonucleo-	oligonucleo-	FW
cord-266230-ia04jc9j	43	26	"	"	``
cord-266230-ia04jc9j	43	27	PI3	pi3	NN
cord-266230-ia04jc9j	43	28	tide	tide	NN
cord-266230-ia04jc9j	43	29	primer	primer	NN
cord-266230-ia04jc9j	43	30	(	(	-LRB-
cord-266230-ia04jc9j	43	31	S'GCCTICGATGGCAACC	S'GCCTICGATGGCAACC	NNP
cord-266230-ia04jc9j	43	32	3	3	NNP
cord-266230-ia04jc9j	43	33	'	'	POS
cord-266230-ia04jc9j	43	34	)	)	-RRB-
cord-266230-ia04jc9j	43	35	complementary	complementary	JJ
cord-266230-ia04jc9j	43	36	to	to	IN
cord-266230-ia04jc9j	43	37	nucleotide	nucleotide	JJ
cord-266230-ia04jc9j	43	38	positions	position	NNS
cord-266230-ia04jc9j	43	39	115-l	115-l	CD
cord-266230-ia04jc9j	43	40	30	30	CD
cord-266230-ia04jc9j	43	41	as	as	IN
cord-266230-ia04jc9j	43	42	described	describe	VBN
cord-266230-ia04jc9j	43	43	previously	previously	RB
cord-266230-ia04jc9j	43	44	(	(	-LRB-
cord-266230-ia04jc9j	43	45	I	-PRON-	PRP
cord-266230-ia04jc9j	43	46	I	i	NN
cord-266230-ia04jc9j	43	47	)	)	-RRB-
cord-266230-ia04jc9j	43	48	.	.	.
cord-266230-ia04jc9j	44	1	The	the	DT
cord-266230-ia04jc9j	44	2	sequencing	sequencing	NN
cord-266230-ia04jc9j	44	3	gel	gel	NN
cord-266230-ia04jc9j	44	4	obtained	obtain	VBN
cord-266230-ia04jc9j	44	5	from	from	IN
cord-266230-ia04jc9j	44	6	this	this	DT
cord-266230-ia04jc9j	44	7	experiment	experiment	NN
cord-266230-ia04jc9j	44	8	terminated	terminate	VBN
cord-266230-ia04jc9j	44	9	with	with	IN
cord-266230-ia04jc9j	44	10	two	two	CD
cord-266230-ia04jc9j	44	11	strong	strong	JJ
cord-266230-ia04jc9j	44	12	stop	stop	NN
cord-266230-ia04jc9j	44	13	points	point	NNS
cord-266230-ia04jc9j	44	14	in	in	IN
cord-266230-ia04jc9j	44	15	all	all	DT
cord-266230-ia04jc9j	44	16	four	four	CD
cord-266230-ia04jc9j	44	17	lanes	lane	NNS
cord-266230-ia04jc9j	44	18	which	which	WDT
cord-266230-ia04jc9j	44	19	likely	likely	RB
cord-266230-ia04jc9j	44	20	correspond	correspond	VBP
cord-266230-ia04jc9j	44	21	to	to	IN
cord-266230-ia04jc9j	44	22	the	the	DT
cord-266230-ia04jc9j	44	23	first	first	JJ
cord-266230-ia04jc9j	44	24	and	and	CC
cord-266230-ia04jc9j	44	25	second	second	JJ
cord-266230-ia04jc9j	44	26	nucleotides	nucleotide	NNS
cord-266230-ia04jc9j	44	27	of	of	IN
cord-266230-ia04jc9j	44	28	TomRSV	TomRSV	NNP
cord-266230-ia04jc9j	44	29	RNA1	RNA1	NNP
cord-266230-ia04jc9j	44	30	(	(	-LRB-
cord-266230-ia04jc9j	44	31	each	each	DT
cord-266230-ia04jc9j	44	32	denoted	denote	VBN
cord-266230-ia04jc9j	44	33	N	N	NNP
cord-266230-ia04jc9j	44	34	in	in	IN
cord-266230-ia04jc9j	44	35	Fig	Fig	NNP
cord-266230-ia04jc9j	44	36	.	.	.
cord-266230-ia04jc9j	44	37	ZA	ZA	NNP
cord-266230-ia04jc9j	44	38	)	)	-RRB-
cord-266230-ia04jc9j	44	39	.	.	.
cord-266230-ia04jc9j	45	1	Nucleotide	nucleotide	JJ
cord-266230-ia04jc9j	45	2	sequence	sequence	NN
cord-266230-ia04jc9j	45	3	comparison	comparison	NN
cord-266230-ia04jc9j	45	4	of	of	IN
cord-266230-ia04jc9j	45	5	the	the	DT
cord-266230-ia04jc9j	45	6	5'termini	5'termini	CD
cord-266230-ia04jc9j	45	7	of	of	IN
cord-266230-ia04jc9j	45	8	TomRSV	TomRSV	NNP
cord-266230-ia04jc9j	45	9	RNA1	RNA1	NNP
cord-266230-ia04jc9j	45	10	and	and	CC
cord-266230-ia04jc9j	45	11	RNA2	RNA2	NNP
cord-266230-ia04jc9j	45	12	revealed	reveal	VBD
cord-266230-ia04jc9j	45	13	that	that	IN
cord-266230-ia04jc9j	45	14	within	within	IN
cord-266230-ia04jc9j	45	15	the	the	DT
cord-266230-ia04jc9j	45	16	first	first	JJ
cord-266230-ia04jc9j	45	17	907	907	CD
cord-266230-ia04jc9j	45	18	nt	nt	NN
cord-266230-ia04jc9j	45	19	,	,	,
cord-266230-ia04jc9j	45	20	88.8	88.8	CD
cord-266230-ia04jc9j	45	21	%	%	NN
cord-266230-ia04jc9j	45	22	of	of	IN
cord-266230-ia04jc9j	45	23	the	the	DT
cord-266230-ia04jc9j	45	24	nucleotide	nucleotide	JJ
cord-266230-ia04jc9j	45	25	positions	position	NNS
cord-266230-ia04jc9j	45	26	are	be	VBP
cord-266230-ia04jc9j	45	27	identical	identical	JJ
cord-266230-ia04jc9j	45	28	.	.	.
cord-266230-ia04jc9j	46	1	The	the	DT
cord-266230-ia04jc9j	46	2	first	first	JJ
cord-266230-ia04jc9j	46	3	459	459	CD
cord-266230-ia04jc9j	46	4	nt	nt	RB
cord-266230-ia04jc9j	46	5	of	of	IN
cord-266230-ia04jc9j	46	6	TomRSV	TomRSV	NNP
cord-266230-ia04jc9j	46	7	RNA1	RNA1	NNP
cord-266230-ia04jc9j	46	8	and	and	CC
cord-266230-ia04jc9j	46	9	RNA2	RNA2	NNP
cord-266230-ia04jc9j	46	10	are	be	VBP
cord-266230-ia04jc9j	46	11	identical	identical	JJ
cord-266230-ia04jc9j	46	12	.	.	.
cord-266230-ia04jc9j	47	1	This	this	DT
cord-266230-ia04jc9j	47	2	region	region	NN
cord-266230-ia04jc9j	47	3	includes	include	VBZ
cord-266230-ia04jc9j	47	4	the	the	DT
cord-266230-ia04jc9j	47	5	5	5	CD
cord-266230-ia04jc9j	47	6	'	'	POS
cord-266230-ia04jc9j	47	7	noncoding	noncoding	JJ
cord-266230-ia04jc9j	47	8	regions	region	NNS
cord-266230-ia04jc9j	47	9	of	of	IN
cord-266230-ia04jc9j	47	10	RNA1	RNA1	NNP
cord-266230-ia04jc9j	47	11	and	and	CC
cord-266230-ia04jc9j	47	12	RNA2	RNA2	NNP
cord-266230-ia04jc9j	47	13	as	as	RB
cord-266230-ia04jc9j	47	14	well	well	RB
cord-266230-ia04jc9j	47	15	as	as	IN
cord-266230-ia04jc9j	47	16	two	two	CD
cord-266230-ia04jc9j	47	17	potential	potential	NN
cord-266230-ia04jc9j	47	18	in	in	IN
cord-266230-ia04jc9j	47	19	-	-	HYPH
cord-266230-ia04jc9j	47	20	frame	frame	NN
cord-266230-ia04jc9j	47	21	translation	translation	NN
cord-266230-ia04jc9j	47	22	initiation	initiation	NN
cord-266230-ia04jc9j	47	23	sites	site	NNS
cord-266230-ia04jc9j	47	24	at	at	IN
cord-266230-ia04jc9j	47	25	AUGTB	AUGTB	NNP
cord-266230-ia04jc9j	47	26	and	and	CC
cord-266230-ia04jc9j	47	27	AUG	AUG	NNP
cord-266230-ia04jc9j	47	28	,	,	,
cord-266230-ia04jc9j	47	29	,	,	,
cord-266230-ia04jc9j	47	30	,	,	,
cord-266230-ia04jc9j	47	31	.	.	.
cord-266230-ia04jc9j	48	1	Beginning	begin	VBG
cord-266230-ia04jc9j	48	2	from	from	IN
cord-266230-ia04jc9j	48	3	the	the	DT
cord-266230-ia04jc9j	48	4	first	first	JJ
cord-266230-ia04jc9j	48	5	potential	potential	NN
cord-266230-ia04jc9j	48	6	in	in	IN
cord-266230-ia04jc9j	48	7	-	-	HYPH
cord-266230-ia04jc9j	48	8	frame	frame	NN
cord-266230-ia04jc9j	48	9	initiation	initiation	NN
cord-266230-ia04jc9j	48	10	site	site	NN
cord-266230-ia04jc9j	48	11	at	at	IN
cord-266230-ia04jc9j	48	12	AUG	AUG	NNP
cord-266230-ia04jc9j	48	13	,	,	,
cord-266230-ia04jc9j	48	14	B	B	NNP
cord-266230-ia04jc9j	48	15	,	,	,
cord-266230-ia04jc9j	48	16	the	the	DT
cord-266230-ia04jc9j	48	17	N	n	CD
cord-266230-ia04jc9j	48	18	-	-	HYPH
cord-266230-ia04jc9j	48	19	terminal	terminal	NN
cord-266230-ia04jc9j	48	20	regions	region	NNS
cord-266230-ia04jc9j	48	21	of	of	IN
cord-266230-ia04jc9j	48	22	the	the	DT
cord-266230-ia04jc9j	48	23	TomRSV	TomRSV	NNP
cord-266230-ia04jc9j	48	24	RNA1	RNA1	NNP
cord-266230-ia04jc9j	48	25	and	and	CC
cord-266230-ia04jc9j	48	26	RNA2	RNA2	NNP
cord-266230-ia04jc9j	48	27	polyproteins	polyprotein	NNS
cord-266230-ia04jc9j	48	28	are	be	VBP
cord-266230-ia04jc9j	48	29	identical	identical	JJ
cord-266230-ia04jc9j	48	30	for	for	IN
cord-266230-ia04jc9j	48	31	the	the	DT
cord-266230-ia04jc9j	48	32	first	first	JJ
cord-266230-ia04jc9j	48	33	132	132	CD
cord-266230-ia04jc9j	48	34	amino	amino	JJ
cord-266230-ia04jc9j	48	35	acids	acid	NNS
cord-266230-ia04jc9j	48	36	,	,	,
cord-266230-ia04jc9j	48	37	and	and	CC
cord-266230-ia04jc9j	48	38	of	of	IN
cord-266230-ia04jc9j	48	39	the	the	DT
cord-266230-ia04jc9j	48	40	next	next	JJ
cord-266230-ia04jc9j	48	41	145	145	CD
cord-266230-ia04jc9j	48	42	amino	amino	NN
cord-266230-ia04jc9j	48	43	acid	acid	NN
cord-266230-ia04jc9j	48	44	residues	residue	NNS
cord-266230-ia04jc9j	48	45	75.3	75.3	CD
cord-266230-ia04jc9j	48	46	%	%	NN
cord-266230-ia04jc9j	48	47	of	of	IN
cord-266230-ia04jc9j	48	48	the	the	DT
cord-266230-ia04jc9j	48	49	positions	position	NNS
cord-266230-ia04jc9j	48	50	are	be	VBP
cord-266230-ia04jc9j	48	51	identical	identical	JJ
cord-266230-ia04jc9j	49	1	(	(	-LRB-
cord-266230-ia04jc9j	49	2	Fig	Fig	NNP
cord-266230-ia04jc9j	49	3	.	.	.
cord-266230-ia04jc9j	49	4	3A	3A	NNP
cord-266230-ia04jc9j	49	5	)	)	-RRB-
cord-266230-ia04jc9j	49	6	.	.	.
cord-266230-ia04jc9j	50	1	It	-PRON-	PRP
cord-266230-ia04jc9j	50	2	is	be	VBZ
cord-266230-ia04jc9j	50	3	perhaps	perhaps	RB
cord-266230-ia04jc9j	50	4	significant	significant	JJ
cord-266230-ia04jc9j	50	5	that	that	IN
cord-266230-ia04jc9j	50	6	the	the	DT
cord-266230-ia04jc9j	50	7	second	second	JJ
cord-266230-ia04jc9j	50	8	in	in	IN
cord-266230-ia04jc9j	50	9	-	-	HYPH
cord-266230-ia04jc9j	50	10	frame	frame	NN
cord-266230-ia04jc9j	50	11	initiation	initiation	NN
cord-266230-ia04jc9j	50	12	site	site	NN
cord-266230-ia04jc9j	50	13	at	at	IN
cord-266230-ia04jc9j	50	14	AUG	AUG	NNP
cord-266230-ia04jc9j	50	15	,	,	,
cord-266230-ia04jc9j	50	16	,	,	,
cord-266230-ia04jc9j	50	17	occurs	occur	VBZ
cord-266230-ia04jc9j	50	18	shortly	shortly	RB
cord-266230-ia04jc9j	50	19	after	after	IN
cord-266230-ia04jc9j	50	20	the	the	DT
cord-266230-ia04jc9j	50	21	point	point	NN
cord-266230-ia04jc9j	50	22	where	where	WRB
cord-266230-ia04jc9j	50	23	the	the	DT
cord-266230-ia04jc9j	50	24	homology	homology	NN
cord-266230-ia04jc9j	50	25	between	between	IN
cord-266230-ia04jc9j	50	26	the	the	DT
cord-266230-ia04jc9j	50	27	RNA1	RNA1	NNP
cord-266230-ia04jc9j	50	28	and	and	CC
cord-266230-ia04jc9j	50	29	the	the	DT
cord-266230-ia04jc9j	50	30	RNA2	RNA2	NNP
cord-266230-ia04jc9j	50	31	polyproteins	polyprotein	NNS
cord-266230-ia04jc9j	50	32	becomes	become	VBZ
cord-266230-ia04jc9j	50	33	less	less	RBR
cord-266230-ia04jc9j	50	34	than	than	IN
cord-266230-ia04jc9j	50	35	perfect	perfect	JJ
cord-266230-ia04jc9j	50	36	.	.	.
cord-266230-ia04jc9j	51	1	As	as	IN
cord-266230-ia04jc9j	51	2	described	describe	VBN
cord-266230-ia04jc9j	51	3	in	in	IN
cord-266230-ia04jc9j	51	4	a	a	DT
cord-266230-ia04jc9j	51	5	previous	previous	JJ
cord-266230-ia04jc9j	51	6	paper	paper	NN
cord-266230-ia04jc9j	51	7	(	(	-LRB-
cord-266230-ia04jc9j	51	8	1	1	CD
cord-266230-ia04jc9j	51	9	I	I	NNP
cord-266230-ia04jc9j	51	10	)	)	-RRB-
cord-266230-ia04jc9j	51	11	,	,	,
cord-266230-ia04jc9j	51	12	AUG	AUG	NNP
cord-266230-ia04jc9j	51	13	,	,	,
cord-266230-ia04jc9j	51	14	,	,	,
cord-266230-ia04jc9j	51	15	,	,	,
cord-266230-ia04jc9j	51	16	is	be	VBZ
cord-266230-ia04jc9j	51	17	in	in	IN
cord-266230-ia04jc9j	51	18	a	a	DT
cord-266230-ia04jc9j	51	19	better	well	JJR
cord-266230-ia04jc9j	51	20	Kozak	Kozak	NNP
cord-266230-ia04jc9j	51	21	context	context	NN
cord-266230-ia04jc9j	51	22	for	for	IN
cord-266230-ia04jc9j	51	23	the	the	DT
cord-266230-ia04jc9j	51	24	initiation	initiation	NN
cord-266230-ia04jc9j	51	25	of	of	IN
cord-266230-ia04jc9j	51	26	translation	translation	NN
cord-266230-ia04jc9j	51	27	than	than	IN
cord-266230-ia04jc9j	51	28	AUG	AUG	NNP
cord-266230-ia04jc9j	51	29	,	,	,
cord-266230-ia04jc9j	51	30	,	,	,
cord-266230-ia04jc9j	51	31	(	(	-LRB-
cord-266230-ia04jc9j	51	32	13	13	CD
cord-266230-ia04jc9j	51	33	)	)	-RRB-
cord-266230-ia04jc9j	51	34	.	.	.
cord-266230-ia04jc9j	52	1	Since	since	IN
cord-266230-ia04jc9j	52	2	it	-PRON-	PRP
cord-266230-ia04jc9j	52	3	is	be	VBZ
cord-266230-ia04jc9j	52	4	unknown	unknown	JJ
cord-266230-ia04jc9j	52	5	whether	whether	IN
cord-266230-ia04jc9j	52	6	AUG	AUG	NNP
cord-266230-ia04jc9j	52	7	,	,	,
cord-266230-ia04jc9j	52	8	,	,	,
cord-266230-ia04jc9j	52	9	and/or	and/or	CC
cord-266230-ia04jc9j	52	10	AUG	AUG	NNP
cord-266230-ia04jc9j	52	11	,	,	,
cord-266230-ia04jc9j	52	12	,	,	,
cord-266230-ia04jc9j	52	13	,	,	,
cord-266230-ia04jc9j	52	14	act	act	VB
cord-266230-ia04jc9j	52	15	as	as	IN
cord-266230-ia04jc9j	52	16	initiation	initiation	NN
cord-266230-ia04jc9j	52	17	sites	site	NNS
cord-266230-ia04jc9j	52	18	for	for	IN
cord-266230-ia04jc9j	52	19	translation	translation	NN
cord-266230-ia04jc9j	52	20	,	,	,
cord-266230-ia04jc9j	52	21	it	-PRON-	PRP
cord-266230-ia04jc9j	52	22	can	can	MD
cord-266230-ia04jc9j	52	23	not	not	RB
cord-266230-ia04jc9j	52	24	be	be	VB
cord-266230-ia04jc9j	52	25	said	say	VBN
cord-266230-ia04jc9j	52	26	whether	whether	IN
cord-266230-ia04jc9j	52	27	it	-PRON-	PRP
cord-266230-ia04jc9j	52	28	is	be	VBZ
cord-266230-ia04jc9j	52	29	the	the	DT
cord-266230-ia04jc9j	52	30	conservation	conservation	NN
cord-266230-ia04jc9j	52	31	of	of	IN
cord-266230-ia04jc9j	52	32	amino	amino	NN
cord-266230-ia04jc9j	52	33	acid	acid	NN
cord-266230-ia04jc9j	52	34	or	or	CC
cord-266230-ia04jc9j	52	35	nucleotide	nucleotide	JJ
cord-266230-ia04jc9j	52	36	sequence	sequence	NN
cord-266230-ia04jc9j	52	37	between	between	IN
cord-266230-ia04jc9j	52	38	AUG	AUG	NNP
cord-266230-ia04jc9j	52	39	,	,	,
cord-266230-ia04jc9j	52	40	,	,	,
cord-266230-ia04jc9j	52	41	and	and	CC
cord-266230-ia04jc9j	52	42	AUG	AUG	NNP
cord-266230-ia04jc9j	52	43	,	,	,
cord-266230-ia04jc9j	52	44	,	,	,
cord-266230-ia04jc9j	52	45	,	,	,
cord-266230-ia04jc9j	52	46	on	on	IN
cord-266230-ia04jc9j	52	47	RNA1	RNA1	NNP
cord-266230-ia04jc9j	52	48	and	and	CC
cord-266230-ia04jc9j	52	49	RNA2	RNA2	NNP
cord-266230-ia04jc9j	52	50	which	which	WDT
cord-266230-ia04jc9j	52	51	is	be	VBZ
cord-266230-ia04jc9j	52	52	most	most	RBS
cord-266230-ia04jc9j	52	53	significant	significant	JJ
cord-266230-ia04jc9j	52	54	.	.	.
cord-266230-ia04jc9j	53	1	The	the	DT
cord-266230-ia04jc9j	53	2	deduced	deduce	VBN
cord-266230-ia04jc9j	53	3	amino	amino	NN
cord-266230-ia04jc9j	53	4	acid	acid	NN
cord-266230-ia04jc9j	53	5	sequence	sequence	NN
cord-266230-ia04jc9j	53	6	of	of	IN
cord-266230-ia04jc9j	53	7	the	the	DT
cord-266230-ia04jc9j	53	8	regions	region	NNS
cord-266230-ia04jc9j	53	9	beginning	begin	VBG
cord-266230-ia04jc9j	53	10	shortly	shortly	RB
cord-266230-ia04jc9j	53	11	after	after	IN
cord-266230-ia04jc9j	53	12	AUG	AUG	NNP
cord-266230-ia04jc9j	53	13	,	,	,
cord-266230-ia04jc9j	53	14	,	,	,
cord-266230-ia04jc9j	53	15	,	,	,
cord-266230-ia04jc9j	53	16	on	on	IN
cord-266230-ia04jc9j	53	17	RNA1	RNA1	NNP
cord-266230-ia04jc9j	53	18	and	and	CC
cord-266230-ia04jc9j	53	19	RNA2	RNA2	NNP
cord-266230-ia04jc9j	53	20	could	could	MD
cord-266230-ia04jc9j	53	21	be	be	VB
cord-266230-ia04jc9j	53	22	aligned	align	VBN
cord-266230-ia04jc9j	53	23	with	with	IN
cord-266230-ia04jc9j	53	24	the	the	DT
cord-266230-ia04jc9j	53	25	deduced	deduce	VBN
cord-266230-ia04jc9j	53	26	amino	amino	NN
cord-266230-ia04jc9j	53	27	acid	acid	NN
cord-266230-ia04jc9j	53	28	sequences	sequence	NNS
cord-266230-ia04jc9j	53	29	encoded	encode	VBN
cord-266230-ia04jc9j	53	30	by	by	IN
cord-266230-ia04jc9j	53	31	the	the	DT
cord-266230-ia04jc9j	53	32	5	5	CD
cord-266230-ia04jc9j	53	33	'	'	POS
cord-266230-ia04jc9j	53	34	terminal	terminal	JJ
cord-266230-ia04jc9j	53	35	region	region	NN
cord-266230-ia04jc9j	53	36	of	of	IN
cord-266230-ia04jc9j	53	37	RNA1	RNA1	NNP
cord-266230-ia04jc9j	53	38	of	of	IN
cord-266230-ia04jc9j	53	39	the	the	DT
cord-266230-ia04jc9j	53	40	nepoviruses	nepoviruses	NNP
cord-266230-ia04jc9j	53	41	tomato	tomato	NN
cord-266230-ia04jc9j	53	42	blackring	blackring	NN
cord-266230-ia04jc9j	53	43	(	(	-LRB-
cord-266230-ia04jc9j	53	44	TBRV	TBRV	NNP
cord-266230-ia04jc9j	53	45	)	)	-RRB-
cord-266230-ia04jc9j	53	46	and	and	CC
cord-266230-ia04jc9j	53	47	grapevine	grapevine	NN
cord-266230-ia04jc9j	53	48	chrome	chrome	NN
cord-266230-ia04jc9j	53	49	mosaic	mosaic	NN
cord-266230-ia04jc9j	54	1	(	(	-LRB-
cord-266230-ia04jc9j	54	2	GCMV	GCMV	NNP
cord-266230-ia04jc9j	54	3	)	)	-RRB-
cord-266230-ia04jc9j	55	1	(	(	-LRB-
cord-266230-ia04jc9j	55	2	14	14	CD
cord-266230-ia04jc9j	55	3	,	,	,
cord-266230-ia04jc9j	55	4	15	15	CD
cord-266230-ia04jc9j	55	5	)	)	-RRB-
cord-266230-ia04jc9j	55	6	(	(	-LRB-
cord-266230-ia04jc9j	55	7	Fig	Fig	NNP
cord-266230-ia04jc9j	55	8	.	.	.
cord-266230-ia04jc9j	55	9	3B	3B	NNP
cord-266230-ia04jc9j	55	10	)	)	-RRB-
cord-266230-ia04jc9j	55	11	.	.	.
cord-266230-ia04jc9j	56	1	The	the	DT
cord-266230-ia04jc9j	56	2	fact	fact	NN
cord-266230-ia04jc9j	56	3	that	that	IN
cord-266230-ia04jc9j	56	4	these	these	DT
cord-266230-ia04jc9j	56	5	regions	region	NNS
cord-266230-ia04jc9j	56	6	of	of	IN
cord-266230-ia04jc9j	56	7	similarity	similarity	NN
cord-266230-ia04jc9j	56	8	are	be	VBP
cord-266230-ia04jc9j	56	9	present	present	JJ
cord-266230-ia04jc9j	56	10	only	only	RB
cord-266230-ia04jc9j	56	11	at	at	IN
cord-266230-ia04jc9j	56	12	the	the	DT
cord-266230-ia04jc9j	56	13	N	N	NNP
cord-266230-ia04jc9j	56	14	-	-	HYPH
cord-266230-ia04jc9j	56	15	termini	termini	NNP
cord-266230-ia04jc9j	56	16	of	of	IN
cord-266230-ia04jc9j	56	17	the	the	DT
cord-266230-ia04jc9j	56	18	TBRV	TBRV	NNP
cord-266230-ia04jc9j	56	19	and	and	CC
cord-266230-ia04jc9j	56	20	GCMV	GCMV	NNP
cord-266230-ia04jc9j	56	21	RNAl	RNAl	NNS
cord-266230-ia04jc9j	56	22	-	-	HYPH
cord-266230-ia04jc9j	56	23	encoded	encode	VBN
cord-266230-ia04jc9j	56	24	polyproteins	polyprotein	NNS
cord-266230-ia04jc9j	56	25	but	but	CC
cord-266230-ia04jc9j	56	26	are	be	VBP
cord-266230-ia04jc9j	56	27	present	present	JJ
cord-266230-ia04jc9j	56	28	at	at	IN
cord-266230-ia04jc9j	56	29	the	the	DT
cord-266230-ia04jc9j	56	30	N	N	NNP
cord-266230-ia04jc9j	56	31	-	-	HYPH
cord-266230-ia04jc9j	56	32	termini	termini	NNP
cord-266230-ia04jc9j	56	33	of	of	IN
cord-266230-ia04jc9j	56	34	both	both	DT
cord-266230-ia04jc9j	56	35	TomRSV	TomRSV	NNP
cord-266230-ia04jc9j	56	36	RNA1	RNA1	NNP
cord-266230-ia04jc9j	57	1	-and	-and	:
cord-266230-ia04jc9j	57	2	RNA2encoded	rna2encode	VBN
cord-266230-ia04jc9j	57	3	pofyproteins	pofyprotein	NNS
cord-266230-ia04jc9j	57	4	suggests	suggest	VBZ
cord-266230-ia04jc9j	57	5	that	that	IN
cord-266230-ia04jc9j	57	6	a	a	DT
cord-266230-ia04jc9j	57	7	large	large	JJ
cord-266230-ia04jc9j	57	8	portion	portion	NN
cord-266230-ia04jc9j	57	9	of	of	IN
cord-266230-ia04jc9j	57	10	coding	code	VBG
cord-266230-ia04jc9j	57	11	and	and	CC
cord-266230-ia04jc9j	57	12	noncoding	noncoding	JJ
cord-266230-ia04jc9j	57	13	sequences	sequence	NNS
cord-266230-ia04jc9j	57	14	at	at	IN
cord-266230-ia04jc9j	57	15	the	the	DT
cord-266230-ia04jc9j	57	16	5	5	CD
cord-266230-ia04jc9j	57	17	'	'	NN
cord-266230-ia04jc9j	57	18	terminus	terminus	NN
cord-266230-ia04jc9j	57	19	of	of	IN
cord-266230-ia04jc9j	57	20	TomRSV	TomRSV	NNP
cord-266230-ia04jc9j	57	21	RNA1	RNA1	NNP
cord-266230-ia04jc9j	57	22	have	have	VBP
cord-266230-ia04jc9j	57	23	been	be	VBN
cord-266230-ia04jc9j	57	24	duplicated	duplicate	VBN
cord-266230-ia04jc9j	57	25	and	and	CC
cord-266230-ia04jc9j	57	26	are	be	VBP
cord-266230-ia04jc9j	57	27	now	now	RB
cord-266230-ia04jc9j	57	28	present	present	JJ
cord-266230-ia04jc9j	57	29	at	at	IN
cord-266230-ia04jc9j	57	30	the	the	DT
cord-266230-ia04jc9j	57	31	5	5	CD
cord-266230-ia04jc9j	57	32	'	'	POS
cord-266230-ia04jc9j	57	33	terrnini	terrnini	NN
cord-266230-ia04jc9j	57	34	of	of	IN
cord-266230-ia04jc9j	57	35	both	both	DT
cord-266230-ia04jc9j	57	36	RNA1	RNA1	NNP
cord-266230-ia04jc9j	57	37	and	and	CC
cord-266230-ia04jc9j	57	38	RNA2	RNA2	NNP
cord-266230-ia04jc9j	57	39	.	.	.
cord-266230-ia04jc9j	58	1	The	the	DT
cord-266230-ia04jc9j	58	2	function	function	NN
cord-266230-ia04jc9j	58	3	of	of	IN
cord-266230-ia04jc9j	58	4	this	this	DT
cord-266230-ia04jc9j	58	5	coding	code	VBG
cord-266230-ia04jc9j	58	6	region	region	NN
cord-266230-ia04jc9j	58	7	in	in	IN
cord-266230-ia04jc9j	58	8	RNA1	RNA1	NNP
cord-266230-ia04jc9j	58	9	is	be	VBZ
cord-266230-ia04jc9j	58	10	unknown	unknown	JJ
cord-266230-ia04jc9j	58	11	,	,	,
cord-266230-ia04jc9j	58	12	however	however	RB
cord-266230-ia04jc9j	58	13	,	,	,
cord-266230-ia04jc9j	58	14	it	-PRON-	PRP
cord-266230-ia04jc9j	58	15	has	have	VBZ
cord-266230-ia04jc9j	58	16	been	be	VBN
cord-266230-ia04jc9j	58	17	suggested	suggest	VBN
cord-266230-ia04jc9j	58	18	that	that	IN
cord-266230-ia04jc9j	58	19	it	-PRON-	PRP
cord-266230-ia04jc9j	58	20	may	may	MD
cord-266230-ia04jc9j	58	21	have	have	VB
cord-266230-ia04jc9j	58	22	a	a	DT
cord-266230-ia04jc9j	58	23	role	role	NN
cord-266230-ia04jc9j	58	24	in	in	IN
cord-266230-ia04jc9j	58	25	proteofytic	proteofytic	JJ
cord-266230-ia04jc9j	58	26	prmessing	prmessing	NN
cord-266230-ia04jc9j	58	27	of	of	IN
cord-266230-ia04jc9j	58	28	the	the	DT
cord-266230-ia04jc9j	58	29	viral	viral	RB
cord-266230-ia04jc9j	58	30	-	-	HYPH
cord-266230-ia04jc9j	58	31	encoded	encoded	JJ
cord-266230-ia04jc9j	58	32	polyprotein	polyprotein	NN
cord-266230-ia04jc9j	58	33	(	(	-LRB-
cord-266230-ia04jc9j	58	34	75	75	CD
cord-266230-ia04jc9j	58	35	)	)	-RRB-
cord-266230-ia04jc9j	58	36	.	.	.
cord-266230-ia04jc9j	59	1	It	-PRON-	PRP
cord-266230-ia04jc9j	59	2	is	be	VBZ
cord-266230-ia04jc9j	59	3	interesting	interesting	JJ
cord-266230-ia04jc9j	59	4	that	that	IN
cord-266230-ia04jc9j	59	5	in	in	IN
cord-266230-ia04jc9j	59	6	vitro	vitro	FW
cord-266230-ia04jc9j	59	7	translation	translation	NN
cord-266230-ia04jc9j	59	8	studies	study	NNS
cord-266230-ia04jc9j	59	9	of	of	IN
cord-266230-ia04jc9j	59	10	cherry	cherry	NNP
cord-266230-ia04jc9j	59	11	feafroll	feafroll	NNP
cord-266230-ia04jc9j	59	12	virus	virus	NN
cord-266230-ia04jc9j	59	13	(	(	-LRB-
cord-266230-ia04jc9j	59	14	CLRV	CLRV	NNP
cord-266230-ia04jc9j	59	15	)	)	-RRB-
cord-266230-ia04jc9j	59	16	RNA2	RNA2	NNP
cord-266230-ia04jc9j	59	17	(	(	-LRB-
cord-266230-ia04jc9j	59	18	16	16	CD
cord-266230-ia04jc9j	59	19	)	)	-RRB-
cord-266230-ia04jc9j	59	20	another	another	DT
cord-266230-ia04jc9j	59	21	nepovirus	nepovirus	NN
cord-266230-ia04jc9j	59	22	with	with	IN
cord-266230-ia04jc9j	59	23	a	a	DT
cord-266230-ia04jc9j	59	24	large	large	JJ
cord-266230-ia04jc9j	59	25	RNA2	RNA2	NNP
cord-266230-ia04jc9j	59	26	component	component	NN
cord-266230-ia04jc9j	59	27	(	(	-LRB-
cord-266230-ia04jc9j	59	28	17	17	CD
cord-266230-ia04jc9j	59	29	)	)	-RRB-
cord-266230-ia04jc9j	59	30	resulted	result	VBD
cord-266230-ia04jc9j	59	31	in	in	IN
cord-266230-ia04jc9j	59	32	proteolytic	proteolytic	JJ
cord-266230-ia04jc9j	59	33	processing	processing	NN
cord-266230-ia04jc9j	59	34	of	of	IN
cord-266230-ia04jc9j	59	35	the	the	DT
cord-266230-ia04jc9j	59	36	RNA2	RNA2	NNP
cord-266230-ia04jc9j	59	37	polyprotein	polyprotein	NN
cord-266230-ia04jc9j	59	38	in	in	IN
cord-266230-ia04jc9j	59	39	the	the	DT
cord-266230-ia04jc9j	59	40	absence	absence	NN
cord-266230-ia04jc9j	59	41	of	of	IN
cord-266230-ia04jc9j	59	42	RNAlencoded	rnalencode	VBN
cord-266230-ia04jc9j	59	43	protease	protease	NN
cord-266230-ia04jc9j	59	44	.	.	.
cord-266230-ia04jc9j	60	1	It	-PRON-	PRP
cord-266230-ia04jc9j	60	2	is	be	VBZ
cord-266230-ia04jc9j	60	3	possible	possible	JJ
cord-266230-ia04jc9j	60	4	that	that	IN
cord-266230-ia04jc9j	60	5	a	a	DT
cord-266230-ia04jc9j	60	6	subgroup	subgroup	NN
cord-266230-ia04jc9j	60	7	of	of	IN
cord-266230-ia04jc9j	60	8	nepoviruses	nepoviruse	NNS
cord-266230-ia04jc9j	60	9	with	with	IN
cord-266230-ia04jc9j	60	10	large	large	JJ
cord-266230-ia04jc9j	60	11	RNA2	RNA2	NNP
cord-266230-ia04jc9j	60	12	components	component	NNS
cord-266230-ia04jc9j	60	13	,	,	,
cord-266230-ia04jc9j	60	14	which	which	WDT
cord-266230-ia04jc9j	60	15	would	would	MD
cord-266230-ia04jc9j	60	16	include	include	VB
cord-266230-ia04jc9j	60	17	TomRSV	TomRSV	NNP
cord-266230-ia04jc9j	60	18	and	and	CC
cord-266230-ia04jc9j	60	19	CLRV	CLRV	NNP
cord-266230-ia04jc9j	60	20	(	(	-LRB-
cord-266230-ia04jc9j	60	21	181	181	CD
cord-266230-ia04jc9j	60	22	,	,	,
cord-266230-ia04jc9j	60	23	may	may	MD
cord-266230-ia04jc9j	60	24	encode	encode	VB
cord-266230-ia04jc9j	60	25	another	another	DT
cord-266230-ia04jc9j	60	26	protease	protease	NN
cord-266230-ia04jc9j	60	27	on	on	IN
cord-266230-ia04jc9j	60	28	RNA2	RNA2	NNP
cord-266230-ia04jc9j	60	29	which	which	WDT
cord-266230-ia04jc9j	60	30	is	be	VBZ
cord-266230-ia04jc9j	60	31	involved	involve	VBN
cord-266230-ia04jc9j	60	32	in	in	IN
cord-266230-ia04jc9j	60	33	proteolytic	proteolytic	JJ
cord-266230-ia04jc9j	60	34	processing	processing	NN
cord-266230-ia04jc9j	60	35	.	.	.
cord-266230-ia04jc9j	61	1	However	however	RB
cord-266230-ia04jc9j	61	2	,	,	,
cord-266230-ia04jc9j	61	3	it	-PRON-	PRP
cord-266230-ia04jc9j	61	4	is	be	VBZ
cord-266230-ia04jc9j	61	5	possibtethirt	possibtethirt	JJ
cord-266230-ia04jc9j	61	6	proteotytic	proteotytic	JJ
cord-266230-ia04jc9j	61	7	processing	processing	NN
cord-266230-ia04jc9j	61	8	of	of	IN
cord-266230-ia04jc9j	61	9	the	the	DT
cord-266230-ia04jc9j	61	10	CLRV	CLRV	NNP
cord-266230-ia04jc9j	61	11	RNA2	RNA2	NNP
cord-266230-ia04jc9j	61	12	polyprotein	polyprotein	NN
cord-266230-ia04jc9j	61	13	may	may	MD
cord-266230-ia04jc9j	61	14	not	not	RB
cord-266230-ia04jc9j	61	15	be	be	VB
cord-266230-ia04jc9j	61	16	due	due	JJ
cord-266230-ia04jc9j	61	17	to	to	IN
cord-266230-ia04jc9j	61	18	a	a	DT
cord-266230-ia04jc9j	61	19	specific	specific	JJ
cord-266230-ia04jc9j	61	20	viral	viral	RB
cord-266230-ia04jc9j	61	21	-	-	HYPH
cord-266230-ia04jc9j	61	22	encoded	encode	VBN
cord-266230-ia04jc9j	61	23	protease	protease	NN
cord-266230-ia04jc9j	61	24	.	.	.
cord-266230-ia04jc9j	62	1	The	the	DT
cord-266230-ia04jc9j	62	2	3	3	CD
cord-266230-ia04jc9j	62	3	'	'	POS
cord-266230-ia04jc9j	62	4	noncoding	noncoding	JJ
cord-266230-ia04jc9j	62	5	regions	region	NNS
cord-266230-ia04jc9j	62	6	of	of	IN
cord-266230-ia04jc9j	62	7	TomfZ@V	tomfz@v	CD
cord-266230-ia04jc9j	62	8	RNA1	RNA1	NNP
cord-266230-ia04jc9j	62	9	and	and	CC
cord-266230-ia04jc9j	62	10	RNA2	RNA2	NNP
cord-266230-ia04jc9j	62	11	are	be	VBP
cord-266230-ia04jc9j	62	12	almost	almost	RB
cord-266230-ia04jc9j	62	13	identical	identical	JJ
cord-266230-ia04jc9j	62	14	for	for	IN
cord-266230-ia04jc9j	62	15	1533	1533	CD
cord-266230-ia04jc9j	62	16	nt	nt	NN
cord-266230-ia04jc9j	62	17	(	(	-LRB-
cord-266230-ia04jc9j	62	18	excluding	exclude	VBG
cord-266230-ia04jc9j	62	19	the	the	DT
cord-266230-ia04jc9j	62	20	3	3	CD
cord-266230-ia04jc9j	62	21	poly(A	poly(a	JJ
cord-266230-ia04jc9j	62	22	)	)	-RRB-
cord-266230-ia04jc9j	62	23	tail	tail	NN
cord-266230-ia04jc9j	62	24	sequence	sequence	NN
cord-266230-ia04jc9j	62	25	)	)	-RRB-
cord-266230-ia04jc9j	62	26	with	with	IN
cord-266230-ia04jc9j	62	27	only	only	RB
cord-266230-ia04jc9j	62	28	three	three	CD
cord-266230-ia04jc9j	62	29	nucleotide	nucleotide	JJ
cord-266230-ia04jc9j	62	30	differences	difference	NNS
cord-266230-ia04jc9j	62	31	at	at	IN
cord-266230-ia04jc9j	62	32	positions	position	NNS
cord-266230-ia04jc9j	62	33	703	703	CD
cord-266230-ia04jc9j	62	34	,	,	,
cord-266230-ia04jc9j	62	35	720	720	CD
cord-266230-ia04jc9j	62	36	,	,	,
cord-266230-ia04jc9j	62	37	and	and	CC
cord-266230-ia04jc9j	62	38	770	770	CD
cord-266230-ia04jc9j	62	39	as	as	IN
cord-266230-ia04jc9j	62	40	shown	show	VBN
cord-266230-ia04jc9j	62	41	in	in	IN
cord-266230-ia04jc9j	62	42	Fig	Fig	NNP
cord-266230-ia04jc9j	62	43	.	.	.
cord-266230-ia04jc9j	62	44	 	 	_SP
cord-266230-ia04jc9j	63	1	2	2	LS
cord-266230-ia04jc9j	64	1	B.	B.	NNP
cord-266230-ia04jc9j	65	1	These	these	DT
cord-266230-ia04jc9j	65	2	sequences	sequence	NNS
cord-266230-ia04jc9j	65	3	are	be	VBP
cord-266230-ia04jc9j	65	4	preceded	precede	VBN
cord-266230-ia04jc9j	65	5	by	by	IN
cord-266230-ia04jc9j	65	6	13	13	CD
cord-266230-ia04jc9j	65	7	and	and	CC
cord-266230-ia04jc9j	65	8	17	17	CD
cord-266230-ia04jc9j	65	9	nt	nt	RB
cord-266230-ia04jc9j	65	10	of	of	IN
cord-266230-ia04jc9j	65	11	noncoding	noncoding	JJ
cord-266230-ia04jc9j	65	12	sequence	sequence	NN
cord-266230-ia04jc9j	65	13	which	which	WDT
cord-266230-ia04jc9j	65	14	are	be	VBP
cord-266230-ia04jc9j	65	15	unique	unique	JJ
cord-266230-ia04jc9j	65	16	to	to	IN
cord-266230-ia04jc9j	65	17	RNA1	RNA1	NNP
cord-266230-ia04jc9j	65	18	and	and	CC
cord-266230-ia04jc9j	65	19	RNA2	RNA2	NNP
cord-266230-ia04jc9j	65	20	,	,	,
cord-266230-ia04jc9j	65	21	respectively	respectively	RB
cord-266230-ia04jc9j	65	22	(	(	-LRB-
cord-266230-ia04jc9j	65	23	UAAAUCCUCWUUG	UAAAUCCUCWUUG	NNP
cord-266230-ia04jc9j	65	24	and	and	CC
cord-266230-ia04jc9j	65	25	tJ&JG	tJ&JG	NNP
cord-266230-ia04jc9j	65	26	-	-	HYPH
cord-266230-ia04jc9j	65	27	UUGGCUUCCUGAA	UUGGCUUCCUGAA	NNP
cord-266230-ia04jc9j	65	28	,	,	,
cord-266230-ia04jc9j	65	29	underlined	underline	VBD
cord-266230-ia04jc9j	65	30	nuclsotides	nuclsotide	NNS
cord-266230-ia04jc9j	65	31	indicate	indicate	VBP
cord-266230-ia04jc9j	65	32	stop	stop	NN
cord-266230-ia04jc9j	65	33	codons	codon	NNS
cord-266230-ia04jc9j	65	34	for	for	IN
cord-266230-ia04jc9j	65	35	the	the	DT
cord-266230-ia04jc9j	65	36	large	large	JJ
cord-266230-ia04jc9j	65	37	ORFs	orfs	NN
cord-266230-ia04jc9j	65	38	of	of	IN
cord-266230-ia04jc9j	65	39	RNA1	RNA1	NNP
cord-266230-ia04jc9j	65	40	and	and	CC
cord-266230-ia04jc9j	65	41	RNA2	RNA2	NNP
cord-266230-ia04jc9j	65	42	,	,	,
cord-266230-ia04jc9j	65	43	respectively	respectively	RB
cord-266230-ia04jc9j	65	44	)	)	-RRB-
cord-266230-ia04jc9j	65	45	.	.	.
cord-266230-ia04jc9j	66	1	When	when	WRB
cord-266230-ia04jc9j	66	2	we	-PRON-	PRP
cord-266230-ia04jc9j	66	3	first	first	RB
cord-266230-ia04jc9j	66	4	reportedthesequence	reportedthesequence	NN
cord-266230-ia04jc9j	66	5	similarity	similarity	NN
cord-266230-ia04jc9j	66	6	at	at	IN
cord-266230-ia04jc9j	66	7	the	the	DT
cord-266230-ia04jc9j	66	8	3'termini	3'termini	CD
cord-266230-ia04jc9j	66	9	of	of	IN
cord-266230-ia04jc9j	66	10	TomRSV	TomRSV	NNP
cord-266230-ia04jc9j	66	11	RPVAl	RPVAl	NNS
cord-266230-ia04jc9j	66	12	and	and	CC
cord-266230-ia04jc9j	66	13	RNA2	RNA2	NNP
cord-266230-ia04jc9j	66	14	(	(	-LRB-
cord-266230-ia04jc9j	66	15	ICI	ICI	NNP
cord-266230-ia04jc9j	66	16	)	)	-RRB-
cord-266230-ia04jc9j	66	17	,	,	,
cord-266230-ia04jc9j	66	18	we	-PRON-	PRP
cord-266230-ia04jc9j	66	19	proposed	propose	VBD
cord-266230-ia04jc9j	66	20	that	that	IN
cord-266230-ia04jc9j	66	21	extensive	extensive	JJ
cord-266230-ia04jc9j	66	22	3	3	CD
cord-266230-ia04jc9j	66	23	'	'	POS
cord-266230-ia04jc9j	66	24	terminel	terminel	NN
cord-266230-ia04jc9j	66	25	identity	identity	NN
cord-266230-ia04jc9j	66	26	between	between	IN
cord-266230-ia04jc9j	66	27	RNA1	RNA1	NNP
cord-266230-ia04jc9j	66	28	and	and	CC
cord-266230-ia04jc9j	66	29	RNA2	RNA2	NNP
cord-266230-ia04jc9j	66	30	may	may	MD
cord-266230-ia04jc9j	66	31	be	be	VB
cord-266230-ia04jc9j	66	32	characteristic	characteristic	JJ
cord-266230-ia04jc9j	66	33	for	for	IN
cord-266230-ia04jc9j	66	34	other	other	JJ
cord-266230-ia04jc9j	66	35	nepoviruses	nepoviruse	NNS
cord-266230-ia04jc9j	66	36	with	with	IN
cord-266230-ia04jc9j	66	37	large	large	JJ
cord-266230-ia04jc9j	66	38	RNA2	RNA2	NNP
cord-266230-ia04jc9j	66	39	components	component	NNS
cord-266230-ia04jc9j	66	40	.	.	.
cord-266230-ia04jc9j	67	1	This	this	DT
cord-266230-ia04jc9j	67	2	has	have	VBZ
cord-266230-ia04jc9j	67	3	been	be	VBN
cord-266230-ia04jc9j	67	4	confirmed	confirm	VBN
cord-266230-ia04jc9j	67	5	for	for	IN
cord-266230-ia04jc9j	67	6	the	the	DT
cord-266230-ia04jc9j	67	7	nepovirus	nepovirus	NNP
cord-266230-ia04jc9j	67	8	CLRV	CLRV	NNP
cord-266230-ia04jc9j	67	9	(	(	-LRB-
cord-266230-ia04jc9j	67	10	19	19	CD
cord-266230-ia04jc9j	67	11	)	)	-RRB-
cord-266230-ia04jc9j	68	1	*	*	NFP
cord-266230-ia04jc9j	68	2	*	*	NFP
cord-266230-ia04jc9j	68	3	*	*	NFP
cord-266230-ia04jc9j	68	4	*	*	NFP
cord-266230-ia04jc9j	68	5	*	*	NFP
cord-266230-ia04jc9j	68	6	*	*	NFP
cord-266230-ia04jc9j	68	7	*	*	NFP
cord-266230-ia04jc9j	68	8	*	*	NFP
cord-266230-ia04jc9j	68	9	*	*	NFP
cord-266230-ia04jc9j	68	10	*	*	NFP
cord-266230-ia04jc9j	68	11	*	*	NFP
cord-266230-ia04jc9j	68	12	*	*	NFP
cord-266230-ia04jc9j	68	13	*	*	NFP
cord-266230-ia04jc9j	68	14	*	*	NFP
cord-266230-ia04jc9j	68	15	*	*	NFP
cord-266230-ia04jc9j	68	16	*	*	NFP
cord-266230-ia04jc9j	68	17	*	*	NFP
cord-266230-ia04jc9j	68	18	*	*	NFP
cord-266230-ia04jc9j	68	19	*	*	NFP
cord-266230-ia04jc9j	68	20	*	*	NFP
cord-266230-ia04jc9j	68	21	*	*	NFP
cord-266230-ia04jc9j	68	22	*	*	NFP
cord-266230-ia04jc9j	68	23	*	*	NFP
cord-266230-ia04jc9j	68	24	*	*	NFP
cord-266230-ia04jc9j	68	25	*	*	NFP
cord-266230-ia04jc9j	68	26	*	*	NFP
cord-266230-ia04jc9j	68	27	*	*	NFP
cord-266230-ia04jc9j	68	28	*	*	NFP
cord-266230-ia04jc9j	68	29	*	*	NFP
cord-266230-ia04jc9j	68	30	*	*	NFP
cord-266230-ia04jc9j	68	31	*	*	NFP
cord-266230-ia04jc9j	68	32	*	*	NFP
cord-266230-ia04jc9j	68	33	*	*	NFP
cord-266230-ia04jc9j	68	34	*	*	NFP
cord-266230-ia04jc9j	68	35	*	*	NFP
cord-266230-ia04jc9j	68	36	*	*	NFP
cord-266230-ia04jc9j	68	37	*	*	NFP
cord-266230-ia04jc9j	68	38	*	*	NFP
cord-266230-ia04jc9j	68	39	*	*	NFP
cord-266230-ia04jc9j	68	40	*	*	NFP
cord-266230-ia04jc9j	68	41	*	*	NFP
cord-266230-ia04jc9j	68	42	*	*	NFP
cord-266230-ia04jc9j	68	43	*	*	NFP
cord-266230-ia04jc9j	68	44	*	*	NFP
cord-266230-ia04jc9j	68	45	*	*	NFP
cord-266230-ia04jc9j	68	46	x	x	NFP
cord-266230-ia04jc9j	68	47	*	*	NFP
cord-266230-ia04jc9j	68	48	*	*	NFP
cord-266230-ia04jc9j	68	49	AALTAPWLLCSYKSGVSSPPpPMTQRQQFAAIKRRLVQKGQQ	aaltapwllcsyksgvssppppmtqrqqfaaikrrlvqkgqq	CD
cord-266230-ia04jc9j	69	1	~IRELIRARKAAKYAlbFAARKKA	~IRELIRARKAAKYAlbFAARKKA	NNP
cord-266230-ia04jc9j	69	2	AAITAPWLLRPCK	AAITAPWLLRPCK	NNP
cord-266230-ia04jc9j	69	3	-	-	HYPH
cord-266230-ia04jc9j	69	4	GEAPPPPPLTQRQQFAALKKRLAVKGQQIIREHIRARKAAKYAAIAKAKKA	GEAPPPPPLTQRQQFAALKKRLAVKGQQIIREHIRARKAAKYAAIAKAKKA	NNP
cord-266230-ia04jc9j	70	1	*	*	NFP
cord-266230-ia04jc9j	70	2	*	*	NFP
cord-266230-ia04jc9j	70	3	*	*	NFP
cord-266230-ia04jc9j	70	4	*	*	NFP
cord-266230-ia04jc9j	70	5	*	*	NFP
cord-266230-ia04jc9j	70	6	*	*	NFP
cord-266230-ia04jc9j	70	7	*	*	NFP
cord-266230-ia04jc9j	70	8	*	*	NFP
cord-266230-ia04jc9j	70	9	*	*	NFP
cord-266230-ia04jc9j	70	10	*	*	NFP
cord-266230-ia04jc9j	70	11	*	*	NFP
cord-266230-ia04jc9j	70	12	*	*	NFP
cord-266230-ia04jc9j	70	13	*	*	NFP
cord-266230-ia04jc9j	70	14	*	*	NFP
cord-266230-ia04jc9j	70	15	*	*	NFP
cord-266230-ia04jc9j	70	16	*	*	NFP
cord-266230-ia04jc9j	70	17	*	*	NFP
cord-266230-ia04jc9j	70	18	*	*	NFP
cord-266230-ia04jc9j	70	19	*	*	NFP
cord-266230-ia04jc9j	70	20	*	*	NFP
cord-266230-ia04jc9j	70	21	*	*	NFP
cord-266230-ia04jc9j	70	22	*	*	NFP
cord-266230-ia04jc9j	70	23	*	*	NFP
cord-266230-ia04jc9j	70	24	*	*	NFP
cord-266230-ia04jc9j	70	25	*	*	NFP
cord-266230-ia04jc9j	70	26	*	*	NFP
cord-266230-ia04jc9j	70	27	*	*	NFP
cord-266230-ia04jc9j	70	28	*	*	NFP
cord-266230-ia04jc9j	70	29	*	*	NFP
cord-266230-ia04jc9j	70	30	*	*	NFP
cord-266230-ia04jc9j	70	31	*	*	NFP
cord-266230-ia04jc9j	70	32	X******R	X******R	.
cord-266230-ia04jc9j	71	1	*	*	NFP
cord-266230-ia04jc9j	71	2	*	*	NFP
cord-266230-ia04jc9j	71	3	*	*	NFP
cord-266230-ia04jc9j	71	4	*	*	NFP
cord-266230-ia04jc9j	71	5	*	*	NFP
cord-266230-ia04jc9j	71	6	*	*	NFP
cord-266230-ia04jc9j	71	7	*	*	NFP
cord-266230-ia04jc9j	71	8	*	*	NFP
cord-266230-ia04jc9j	71	9	x	x	NFP
cord-266230-ia04jc9j	71	10	*	*	NFP
cord-266230-ia04jc9j	71	11	*	*	NFP
cord-266230-ia04jc9j	71	12	*	*	NFP
cord-266230-ia04jc9j	71	13	*	*	NFP
cord-266230-ia04jc9j	71	14	AAVAAQKARAEAPRLAAQKAAIAKILRDRQLVSLPPPPPPS	AAVAAQKARAEAPRLAAQKAAIAKILRDRQLVSLPPPPPPS	NNP
cord-266230-ia04jc9j	72	1	~RL~~A	~rl~~a	JJ
cord-266230-ia04jc9j	72	2	~	~	NFP
cord-266230-ia04jc9j	72	3	SKSASLQRL	SKSASLQRL	NNP
cord-266230-ia04jc9j	72	4	~	~	NFP
cord-266230-ia04jc9j	72	5	FH	FH	NNP
cord-266230-ia04jc9j	72	6	AALfLAVKAAQEAPRLAAQKISKILRDRDRDVAALPPPPPPS	aalflavkaaqeaprlaaqkiskilrdrdrdvaalpppppps	ADD
cord-266230-ia04jc9j	73	1	~RL	~RL	NNP
cord-266230-ia04jc9j	73	2	~	~	NFP
cord-266230-ia04jc9j	73	3	EABLASKAESLRRLKAFK	EABLASKAESLRRLKAFK	NNP
cord-266230-ia04jc9j	74	1	*	*	NFP
cord-266230-ia04jc9j	74	2	*	*	NFP
cord-266230-ia04jc9j	74	3	*	*	NFP
cord-266230-ia04jc9j	74	4	*	*	NFP
cord-266230-ia04jc9j	74	5	*	*	NFP
cord-266230-ia04jc9j	74	6	*	*	NFP
cord-266230-ia04jc9j	74	7	*	*	NFP
cord-266230-ia04jc9j	74	8	*	*	NFP
cord-266230-ia04jc9j	74	9	*	*	NFP
cord-266230-ia04jc9j	74	10	*	*	NFP
cord-266230-ia04jc9j	74	11	*	*	NFP
cord-266230-ia04jc9j	74	12	RANRVRPVLNNSFPSPP	RANRVRPVLNNSFPSPP	NNP
cord-266230-ia04jc9j	75	1	TFSRVRPALNTSFPPPP	TFSRVRPALNTSFPPPP	NNP
cord-266230-ia04jc9j	75	2	shows	show	VBZ
cord-266230-ia04jc9j	75	3	3	3	CD
cord-266230-ia04jc9j	75	4	'	'	POS
cord-266230-ia04jc9j	75	5	noncoding	noncoding	JJ
cord-266230-ia04jc9j	75	6	sequence	sequence	NN
cord-266230-ia04jc9j	75	7	identity	identity	NN
cord-266230-ia04jc9j	75	8	between	between	IN
cord-266230-ia04jc9j	75	9	RNA1	RNA1	NNP
cord-266230-ia04jc9j	76	1	In	in	IN
cord-266230-ia04jc9j	76	2	summary	summary	NN
cord-266230-ia04jc9j	76	3	,	,	,
cord-266230-ia04jc9j	76	4	the	the	DT
cord-266230-ia04jc9j	76	5	total	total	JJ
cord-266230-ia04jc9j	76	6	amount	amount	NN
cord-266230-ia04jc9j	76	7	of	of	IN
cord-266230-ia04jc9j	76	8	duplicated	duplicate	VBN
cord-266230-ia04jc9j	76	9	seand	seand	NN
cord-266230-ia04jc9j	76	10	RNA2	RNA2	NNP
cord-266230-ia04jc9j	76	11	for	for	IN
cord-266230-ia04jc9j	76	12	a	a	DT
cord-266230-ia04jc9j	76	13	length	length	NN
cord-266230-ia04jc9j	76	14	which	which	WDT
cord-266230-ia04jc9j	76	15	is	be	VBZ
cord-266230-ia04jc9j	76	16	similar	similar	JJ
cord-266230-ia04jc9j	76	17	to	to	IN
cord-266230-ia04jc9j	76	18	that	that	DT
cord-266230-ia04jc9j	76	19	found	find	VBN
cord-266230-ia04jc9j	76	20	in	in	IN
cord-266230-ia04jc9j	76	21	quences	quence	NNS
cord-266230-ia04jc9j	76	22	between	between	IN
cord-266230-ia04jc9j	76	23	TomRSV	TomRSV	NNP
cord-266230-ia04jc9j	76	24	RNA1	RNA1	NNP
cord-266230-ia04jc9j	76	25	and	and	CC
cord-266230-ia04jc9j	76	26	RNA2	RNA2	NNP
cord-266230-ia04jc9j	76	27	as	as	RB
cord-266230-ia04jc9j	76	28	well	well	RB
cord-266230-ia04jc9j	76	29	as	as	IN
cord-266230-ia04jc9j	76	30	TomRSV	TomRSV	NNP
cord-266230-ia04jc9j	76	31	.	.	.
cord-266230-ia04jc9j	77	1	However	however	RB
cord-266230-ia04jc9j	77	2	,	,	,
cord-266230-ia04jc9j	77	3	very	very	RB
cord-266230-ia04jc9j	77	4	little	little	JJ
cord-266230-ia04jc9j	77	5	sequence	sequence	NN
cord-266230-ia04jc9j	77	6	similarity	similarity	NN
cord-266230-ia04jc9j	77	7	is	be	VBZ
cord-266230-ia04jc9j	77	8	de	de	VBN
cord-266230-ia04jc9j	77	9	-	-	NN
cord-266230-ia04jc9j	77	10	within	within	IN
cord-266230-ia04jc9j	77	11	RNA2	RNA2	NNP
cord-266230-ia04jc9j	77	12	(	(	-LRB-
cord-266230-ia04jc9j	77	13	see	see	VB
cord-266230-ia04jc9j	77	14	11	11	CD
cord-266230-ia04jc9j	77	15	)	)	-RRB-
cord-266230-ia04jc9j	77	16	accounts	account	NNS
cord-266230-ia04jc9j	77	17	for	for	IN
cord-266230-ia04jc9j	77	18	almost	almost	RB
cord-266230-ia04jc9j	77	19	35	35	CD
cord-266230-ia04jc9j	77	20	%	%	NN
cord-266230-ia04jc9j	77	21	of	of	IN
cord-266230-ia04jc9j	77	22	the	the	DT
cord-266230-ia04jc9j	77	23	tectabJe	tectabje	NN
cord-266230-ia04jc9j	77	24	between	between	IN
cord-266230-ia04jc9j	77	25	the	the	DT
cord-266230-ia04jc9j	77	26	3	3	CD
cord-266230-ia04jc9j	77	27	'	'	POS
cord-266230-ia04jc9j	77	28	noncoding	noncoding	JJ
cord-266230-ia04jc9j	77	29	regions	region	NNS
cord-266230-ia04jc9j	77	30	of	of	IN
cord-266230-ia04jc9j	77	31	TomRSV	TomRSV	NNP
cord-266230-ia04jc9j	77	32	total	total	JJ
cord-266230-ia04jc9j	77	33	genomic	genomic	JJ
cord-266230-ia04jc9j	77	34	sequence	sequence	NN
cord-266230-ia04jc9j	77	35	.	.	.
cord-266230-ia04jc9j	78	1	The	the	DT
cord-266230-ia04jc9j	78	2	extensive	extensive	JJ
cord-266230-ia04jc9j	78	3	amount	amount	NN
cord-266230-ia04jc9j	78	4	of	of	IN
cord-266230-ia04jc9j	78	5	nuand	nuand	NN
cord-266230-ia04jc9j	78	6	CLRV	CLRV	NNP
cord-266230-ia04jc9j	78	7	(	(	-LRB-
cord-266230-ia04jc9j	78	8	19	19	CD
cord-266230-ia04jc9j	78	9	)	)	-RRB-
cord-266230-ia04jc9j	78	10	.	.	.
cord-266230-ia04jc9j	79	1	The	the	DT
cord-266230-ia04jc9j	79	2	3	3	CD
cord-266230-ia04jc9j	79	3	'	'	POS
cord-266230-ia04jc9j	79	4	noncoding	noncoding	JJ
cord-266230-ia04jc9j	79	5	regions	region	NNS
cord-266230-ia04jc9j	79	6	of	of	IN
cord-266230-ia04jc9j	79	7	the	the	DT
cord-266230-ia04jc9j	79	8	two	two	CD
cord-266230-ia04jc9j	79	9	cleotide	cleotide	JJ
cord-266230-ia04jc9j	79	10	sequence	sequence	NN
cord-266230-ia04jc9j	79	11	identity	identity	NN
cord-266230-ia04jc9j	79	12	at	at	IN
cord-266230-ia04jc9j	79	13	the	the	DT
cord-266230-ia04jc9j	79	14	5	5	CD
cord-266230-ia04jc9j	79	15	'	'	''
cord-266230-ia04jc9j	79	16	and	and	CC
cord-266230-ia04jc9j	79	17	3	3	CD
cord-266230-ia04jc9j	79	18	'	'	''
cord-266230-ia04jc9j	79	19	termini	termini	NNP
cord-266230-ia04jc9j	79	20	of	of	IN
cord-266230-ia04jc9j	79	21	RNA	RNA	NNP
cord-266230-ia04jc9j	79	22	components	component	NNS
cord-266230-ia04jc9j	79	23	for	for	IN
cord-266230-ia04jc9j	79	24	several	several	JJ
cord-266230-ia04jc9j	79	25	other	other	JJ
cord-266230-ia04jc9j	79	26	nepoviruses	nepoviruse	NNS
cord-266230-ia04jc9j	79	27	are	be	VBP
cord-266230-ia04jc9j	79	28	TomRSV	TomRSV	NNP
cord-266230-ia04jc9j	79	29	RNA1	RNA1	NNP
cord-266230-ia04jc9j	79	30	and	and	CC
cord-266230-ia04jc9j	79	31	RNA2	RNA2	NNP
cord-266230-ia04jc9j	79	32	may	may	MD
cord-266230-ia04jc9j	79	33	be	be	VB
cord-266230-ia04jc9j	79	34	required	require	VBN
cord-266230-ia04jc9j	79	35	for	for	IN
cord-266230-ia04jc9j	79	36	recognialso	recognialso	NNP
cord-266230-ia04jc9j	79	37	identical	identical	JJ
cord-266230-ia04jc9j	79	38	but	but	CC
cord-266230-ia04jc9j	79	39	much	much	RB
cord-266230-ia04jc9j	79	40	shorter	short	JJR
cord-266230-ia04jc9j	79	41	(	(	-LRB-
cord-266230-ia04jc9j	79	42	less	less	JJR
cord-266230-ia04jc9j	79	43	than	than	IN
cord-266230-ia04jc9j	79	44	300	300	CD
cord-266230-ia04jc9j	79	45	nt	nt	RB
cord-266230-ia04jc9j	79	46	)	)	-RRB-
cord-266230-ia04jc9j	79	47	(	(	-LRB-
cord-266230-ia04jc9j	79	48	74	74	CD
cord-266230-ia04jc9j	79	49	,	,	,
cord-266230-ia04jc9j	79	50	tion	tion	NN
cord-266230-ia04jc9j	79	51	by	by	IN
cord-266230-ia04jc9j	79	52	a	a	DT
cord-266230-ia04jc9j	79	53	highly	highly	RB
cord-266230-ia04jc9j	79	54	selective	selective	JJ
cord-266230-ia04jc9j	79	55	replicsee	replicsee	NN
cord-266230-ia04jc9j	79	56	.	.	.
cord-266230-ia04jc9j	80	1	It	-PRON-	PRP
cord-266230-ia04jc9j	80	2	is	be	VBZ
cord-266230-ia04jc9j	80	3	slso	slso	RB
cord-266230-ia04jc9j	80	4	possible	possible	JJ
cord-266230-ia04jc9j	80	5	15	15	CD
cord-266230-ia04jc9j	80	6	)	)	-RRB-
cord-266230-ia04jc9j	80	7	.	.	.
cord-266230-ia04jc9j	81	1	Extensive	extensive	JJ
cord-266230-ia04jc9j	81	2	sequence	sequence	NN
cord-266230-ia04jc9j	81	3	similarity	similarity	NN
cord-266230-ia04jc9j	81	4	at	at	IN
cord-266230-ia04jc9j	81	5	the	the	DT
cord-266230-ia04jc9j	81	6	3'termini	3'termini	CD
cord-266230-ia04jc9j	81	7	has	have	VBZ
cord-266230-ia04jc9j	81	8	that	that	DT
cord-266230-ia04jc9j	81	9	RNA	RNA	NNP
cord-266230-ia04jc9j	81	10	recombination	recombination	NN
cord-266230-ia04jc9j	81	11	is	be	VBZ
cord-266230-ia04jc9j	81	12	responsible	responsible	JJ
cord-266230-ia04jc9j	81	13	for	for	IN
cord-266230-ia04jc9j	81	14	maintaining	maintain	VBG
cord-266230-ia04jc9j	81	15	also	also	RB
cord-266230-ia04jc9j	81	16	been	be	VBN
cord-266230-ia04jc9j	81	17	reported	report	VBN
cord-266230-ia04jc9j	81	18	for	for	IN
cord-266230-ia04jc9j	81	19	members	member	NNS
cord-266230-ia04jc9j	81	20	of	of	IN
cord-266230-ia04jc9j	81	21	the	the	DT
cord-266230-ia04jc9j	81	22	tobravirus	tobravirus	NNP
cord-266230-ia04jc9j	81	23	nucleotide	nucleotide	JJ
cord-266230-ia04jc9j	81	24	sequence	sequence	NN
cord-266230-ia04jc9j	81	25	identity	identity	NN
cord-266230-ia04jc9j	81	26	at	at	IN
cord-266230-ia04jc9j	81	27	the	the	DT
cord-266230-ia04jc9j	81	28	5	5	CD
cord-266230-ia04jc9j	81	29	'	'	''
cord-266230-ia04jc9j	81	30	and	and	CC
cord-266230-ia04jc9j	81	31	3'termini	3'termini	CD
cord-266230-ia04jc9j	81	32	of	of	IN
cord-266230-ia04jc9j	81	33	group	group	NN
cord-266230-ia04jc9j	81	34	(	(	-LRB-
cord-266230-ia04jc9j	81	35	20	20	CD
cord-266230-ia04jc9j	81	36	,	,	,
cord-266230-ia04jc9j	81	37	21	21	CD
cord-266230-ia04jc9j	81	38	)	)	-RRB-
cord-266230-ia04jc9j	81	39	and	and	CC
cord-266230-ia04jc9j	81	40	includes	include	VBZ
cord-266230-ia04jc9j	81	41	both	both	DT
cord-266230-ia04jc9j	81	42	potential	potential	JJ
cord-266230-ia04jc9j	81	43	coding	code	VBG
cord-266230-ia04jc9j	81	44	se	se	FW
cord-266230-ia04jc9j	81	45	-	-	HYPH
cord-266230-ia04jc9j	81	46	RNA1	RNA1	NNP
cord-266230-ia04jc9j	81	47	and	and	CC
cord-266230-ia04jc9j	81	48	RNA2	RNA2	NNP
cord-266230-ia04jc9j	81	49	.	.	.
cord-266230-ia04jc9j	82	1	RNA	RNA	NNP
cord-266230-ia04jc9j	82	2	recombination	recombination	NN
cord-266230-ia04jc9j	82	3	has	have	VBZ
cord-266230-ia04jc9j	82	4	been	be	VBN
cord-266230-ia04jc9j	82	5	postuquences	postuquence	NNS
cord-266230-ia04jc9j	82	6	and	and	CC
cord-266230-ia04jc9j	82	7	noncoding	noncoding	JJ
cord-266230-ia04jc9j	82	8	sequences	sequence	NNS
cord-266230-ia04jc9j	82	9	.	.	.
cord-266230-ia04jc9j	83	1	lated	late	VBN
cord-266230-ia04jc9j	83	2	to	to	TO
cord-266230-ia04jc9j	83	3	explain	explain	VB
cord-266230-ia04jc9j	83	4	the	the	DT
cord-266230-ia04jc9j	83	5	duplication	duplication	NN
cord-266230-ia04jc9j	83	6	of	of	IN
cord-266230-ia04jc9j	83	7	820	820	CD
cord-266230-ia04jc9j	83	8	nt	nt	RB
cord-266230-ia04jc9j	83	9	at	at	IN
cord-266230-ia04jc9j	83	10	the	the	DT
cord-266230-ia04jc9j	83	11	3'ter-	3'ter-	CD
cord-266230-ia04jc9j	83	12	FIG	fig	NN
cord-266230-ia04jc9j	83	13	.	.	.
cord-266230-ia04jc9j	84	1	2	2	LS
cord-266230-ia04jc9j	84	2	.	.	.
cord-266230-ia04jc9j	85	1	Nucleotide	nucleotide	JJ
cord-266230-ia04jc9j	85	2	sequence	sequence	NN
cord-266230-ia04jc9j	85	3	and	and	CC
cord-266230-ia04jc9j	85	4	deduced	deduce	VBD
cord-266230-ia04jc9j	85	5	amino	amino	NN
cord-266230-ia04jc9j	85	6	acid	acid	NN
cord-266230-ia04jc9j	85	7	sequence	sequence	NN
cord-266230-ia04jc9j	85	8	of	of	IN
cord-266230-ia04jc9j	85	9	the	the	DT
cord-266230-ia04jc9j	85	10	5'(A	5'(a	CD
cord-266230-ia04jc9j	85	11	)	)	-RRB-
cord-266230-ia04jc9j	85	12	and	and	CC
cord-266230-ia04jc9j	85	13	3'(B	3'(B	NNP
cord-266230-ia04jc9j	85	14	)	)	-RRB-
cord-266230-ia04jc9j	85	15	regions	region	NNS
cord-266230-ia04jc9j	85	16	of	of	IN
cord-266230-ia04jc9j	85	17	TomRSV	TomRSV	NNP
cord-266230-ia04jc9j	85	18	RNA1	RNA1	NNP
cord-266230-ia04jc9j	85	19	(	(	-LRB-
cord-266230-ia04jc9j	85	20	A	a	NN
cord-266230-ia04jc9j	85	21	)	)	-RRB-
cord-266230-ia04jc9j	86	1	The	the	DT
cord-266230-ia04jc9j	86	2	first	first	JJ
cord-266230-ia04jc9j	86	3	two	two	CD
cord-266230-ia04jc9j	86	4	nuolaotides	nuolaotide	NNS
cord-266230-ia04jc9j	86	5	which	which	WDT
cord-266230-ia04jc9j	86	6	could	could	MD
cord-266230-ia04jc9j	86	7	not	not	RB
cord-266230-ia04jc9j	86	8	be	be	VB
cord-266230-ia04jc9j	86	9	determined	determine	VBN
cord-266230-ia04jc9j	86	10	from	from	IN
cord-266230-ia04jc9j	86	11	the	the	DT
cord-266230-ia04jc9j	86	12	sequencing	sequencing	NN
cord-266230-ia04jc9j	86	13	gel	gel	NN
cord-266230-ia04jc9j	86	14	are	be	VBP
cord-266230-ia04jc9j	86	15	each	each	DT
cord-266230-ia04jc9j	86	16	represented	represent	VBN
cord-266230-ia04jc9j	86	17	by	by	IN
cord-266230-ia04jc9j	86	18	an	an	DT
cord-266230-ia04jc9j	86	19	N.	n.	NN
cord-266230-ia04jc9j	87	1	The	the	DT
cord-266230-ia04jc9j	87	2	second	second	JJ
cord-266230-ia04jc9j	87	3	in	in	IN
cord-266230-ia04jc9j	87	4	-	-	HYPH
cord-266230-ia04jc9j	87	5	frame	frame	NN
cord-266230-ia04jc9j	87	6	AUG	AUG	NNP
cord-266230-ia04jc9j	87	7	which	which	WDT
cord-266230-ia04jc9j	87	8	is	be	VBZ
cord-266230-ia04jc9j	87	9	a	a	DT
cord-266230-ia04jc9j	87	10	potential	potential	JJ
cord-266230-ia04jc9j	87	11	initiation	initiation	NN
cord-266230-ia04jc9j	87	12	site	site	NN
cord-266230-ia04jc9j	87	13	for	for	IN
cord-266230-ia04jc9j	87	14	translation	translation	NN
cord-266230-ia04jc9j	87	15	is	be	VBZ
cord-266230-ia04jc9j	87	16	underlined	underline	VBN
cord-266230-ia04jc9j	87	17	.	.	.
cord-266230-ia04jc9j	88	1	Nucleotides	nucleotide	NNS
cord-266230-ia04jc9j	88	2	are	be	VBP
cord-266230-ia04jc9j	88	3	numbered	number	VBN
cord-266230-ia04jc9j	88	4	on	on	IN
cord-266230-ia04jc9j	88	5	the	the	DT
cord-266230-ia04jc9j	88	6	left	left	JJ
cord-266230-ia04jc9j	88	7	beginning	beginning	NN
cord-266230-ia04jc9j	88	8	at	at	IN
cord-266230-ia04jc9j	88	9	the	the	DT
cord-266230-ia04jc9j	88	10	first	first	JJ
cord-266230-ia04jc9j	88	11	N.	N.	NNP
cord-266230-ia04jc9j	88	12	Amino	Amino	NNP
cord-266230-ia04jc9j	88	13	acids	acid	NNS
cord-266230-ia04jc9j	88	14	are	be	VBP
cord-266230-ia04jc9j	88	15	numbered	number	VBN
cord-266230-ia04jc9j	88	16	on	on	IN
cord-266230-ia04jc9j	88	17	the	the	DT
cord-266230-ia04jc9j	88	18	right	right	JJ
cord-266230-ia04jc9j	88	19	snd	snd	NN
cord-266230-ia04jc9j	88	20	begin	begin	VB
cord-266230-ia04jc9j	88	21	at	at	IN
cord-266230-ia04jc9j	88	22	the	the	DT
cord-266230-ia04jc9j	88	23	first	first	JJ
cord-266230-ia04jc9j	88	24	M.	M.	NNP
cord-266230-ia04jc9j	88	25	Numbering	Numbering	NNP
cord-266230-ia04jc9j	88	26	in	in	IN
cord-266230-ia04jc9j	88	27	(	(	-LRB-
cord-266230-ia04jc9j	88	28	B	b	NN
cord-266230-ia04jc9j	88	29	)	)	-RRB-
cord-266230-ia04jc9j	89	1	begins	begin	VBZ
cord-266230-ia04jc9j	89	2	at	at	IN
cord-266230-ia04jc9j	89	3	the	the	DT
cord-266230-ia04jc9j	89	4	termination	termination	NN
cord-266230-ia04jc9j	89	5	codon	codon	NN
cord-266230-ia04jc9j	89	6	(	(	-LRB-
cord-266230-ia04jc9j	89	7	WA	WA	NNP
cord-266230-ia04jc9j	89	8	)	)	-RRB-
cord-266230-ia04jc9j	89	9	for	for	IN
cord-266230-ia04jc9j	89	10	the	the	DT
cord-266230-ia04jc9j	89	11	RNAl	RNAl	NNPS
cord-266230-ia04jc9j	89	12	-	-	HYPH
cord-266230-ia04jc9j	89	13	encoded	encode	VBN
cord-266230-ia04jc9j	89	14	long	long	JJ
cord-266230-ia04jc9j	89	15	ORF	ORF	NNP
cord-266230-ia04jc9j	89	16	as	as	IN
cord-266230-ia04jc9j	89	17	determined	determine	VBN
cord-266230-ia04jc9j	89	18	from	from	IN
cord-266230-ia04jc9j	89	19	clone	clone	NN
cord-266230-ia04jc9j	89	20	J.27	j.27	NN
cord-266230-ia04jc9j	89	21	.	.	.
cord-266230-ia04jc9j	90	1	Three	three	CD
cord-266230-ia04jc9j	90	2	nucleotide	nucleotide	JJ
cord-266230-ia04jc9j	90	3	substitutions	substitution	NNS
cord-266230-ia04jc9j	90	4	in	in	IN
cord-266230-ia04jc9j	90	5	the	the	DT
cord-266230-ia04jc9j	90	6	3	3	CD
cord-266230-ia04jc9j	90	7	'	'	POS
cord-266230-ia04jc9j	90	8	noncoding	noncoding	JJ
cord-266230-ia04jc9j	90	9	region	region	NN
cord-266230-ia04jc9j	90	10	of	of	IN
cord-266230-ia04jc9j	90	11	RNA2	RNA2	NNP
cord-266230-ia04jc9j	90	12	(	(	-LRB-
cord-266230-ia04jc9j	90	13	I	I	NNP
cord-266230-ia04jc9j	90	14	7	7	CD
cord-266230-ia04jc9j	90	15	)	)	-RRB-
cord-266230-ia04jc9j	90	16	compared	compare	VBN
cord-266230-ia04jc9j	90	17	to	to	IN
cord-266230-ia04jc9j	90	18	RNA1	RNA1	NNP
cord-266230-ia04jc9j	90	19	are	be	VBP
cord-266230-ia04jc9j	90	20	shown	show	VBN
cord-266230-ia04jc9j	90	21	below	below	IN
cord-266230-ia04jc9j	90	22	the	the	DT
cord-266230-ia04jc9j	90	23	sequence	sequence	NN
cord-266230-ia04jc9j	90	24	of	of	IN
cord-266230-ia04jc9j	90	25	RNA1	RNA1	NNP
cord-266230-ia04jc9j	90	26	mini	mini	NN
cord-266230-ia04jc9j	90	27	of	of	IN
cord-266230-ia04jc9j	90	28	RNA1	RNA1	NNP
cord-266230-ia04jc9j	90	29	and	and	CC
cord-266230-ia04jc9j	90	30	RNA2	RNA2	NNP
cord-266230-ia04jc9j	90	31	of	of	IN
cord-266230-ia04jc9j	90	32	the	the	DT
cord-266230-ia04jc9j	90	33	tobravirus	tobravirus	NNP
cord-266230-ia04jc9j	90	34	tobacco	tobacco	NN
cord-266230-ia04jc9j	90	35	rattle	rattle	NN
cord-266230-ia04jc9j	90	36	virus	virus	NN
cord-266230-ia04jc9j	90	37	(	(	-LRB-
cord-266230-ia04jc9j	90	38	TRV	TRV	NNP
cord-266230-ia04jc9j	90	39	)	)	-RRB-
cord-266230-ia04jc9j	90	40	strain	strain	VBP
cord-266230-ia04jc9j	90	41	PLB	PLB	NNP
cord-266230-ia04jc9j	90	42	(	(	-LRB-
cord-266230-ia04jc9j	90	43	6	6	CD
cord-266230-ia04jc9j	90	44	)	)	-RRB-
cord-266230-ia04jc9j	90	45	.	.	.
cord-266230-ia04jc9j	91	1	However	however	RB
cord-266230-ia04jc9j	91	2	,	,	,
cord-266230-ia04jc9j	91	3	after	after	IN
cord-266230-ia04jc9j	91	4	several	several	JJ
cord-266230-ia04jc9j	91	5	passages	passage	NNS
cord-266230-ia04jc9j	91	6	of	of	IN
cord-266230-ia04jc9j	91	7	a	a	DT
cord-266230-ia04jc9j	91	8	pseudorecombinant	pseudorecombinant	NN
cord-266230-ia04jc9j	91	9	consisting	consisting	NN
cord-266230-ia04jc9j	91	10	of	of	IN
cord-266230-ia04jc9j	91	11	RNA1	RNA1	NNP
cord-266230-ia04jc9j	91	12	from	from	IN
cord-266230-ia04jc9j	91	13	TRV	TRV	NNP
cord-266230-ia04jc9j	91	14	strain	strain	NN
cord-266230-ia04jc9j	91	15	TCM	TCM	NNP
cord-266230-ia04jc9j	91	16	and	and	CC
cord-266230-ia04jc9j	91	17	RNA2	RNA2	NNP
cord-266230-ia04jc9j	91	18	from	from	IN
cord-266230-ia04jc9j	91	19	strain	strain	NN
cord-266230-ia04jc9j	91	20	PLB	PLB	NNP
cord-266230-ia04jc9j	91	21	,	,	,
cord-266230-ia04jc9j	91	22	which	which	WDT
cord-266230-ia04jc9j	91	23	differ	differ	VBP
cord-266230-ia04jc9j	91	24	at	at	IN
cord-266230-ia04jc9j	91	25	their	-PRON-	PRP$
cord-266230-ia04jc9j	91	26	3'termini	3'termini	CD
cord-266230-ia04jc9j	91	27	in	in	IN
cord-266230-ia04jc9j	91	28	39	39	CD
cord-266230-ia04jc9j	91	29	of	of	IN
cord-266230-ia04jc9j	91	30	820	820	CD
cord-266230-ia04jc9j	91	31	nt	nt	NN
cord-266230-ia04jc9j	91	32	,	,	,
cord-266230-ia04jc9j	91	33	a	a	DT
cord-266230-ia04jc9j	91	34	recombinant	recombinant	JJ
cord-266230-ia04jc9j	91	35	RNA	RNA	NNP
cord-266230-ia04jc9j	91	36	molecule	molecule	NN
cord-266230-ia04jc9j	91	37	was	be	VBD
cord-266230-ia04jc9j	91	38	not	not	RB
cord-266230-ia04jc9j	91	39	detected	detect	VBN
cord-266230-ia04jc9j	91	40	.	.	.
cord-266230-ia04jc9j	92	1	Not	not	RB
cord-266230-ia04jc9j	92	2	only	only	RB
cord-266230-ia04jc9j	92	3	was	be	VBD
cord-266230-ia04jc9j	92	4	RNA	RNA	NNP
cord-266230-ia04jc9j	92	5	recombination	recombination	NN
cord-266230-ia04jc9j	92	6	in	in	IN
cord-266230-ia04jc9j	92	7	this	this	DT
cord-266230-ia04jc9j	92	8	system	system	NN
cord-266230-ia04jc9j	92	9	not	not	RB
cord-266230-ia04jc9j	92	10	detected	detect	VBN
cord-266230-ia04jc9j	92	11	experimentally	experimentally	RB
cord-266230-ia04jc9j	92	12	,	,	,
cord-266230-ia04jc9j	92	13	but	but	CC
cord-266230-ia04jc9j	92	14	the	the	DT
cord-266230-ia04jc9j	92	15	viability	viability	NN
cord-266230-ia04jc9j	92	16	of	of	IN
cord-266230-ia04jc9j	92	17	a	a	DT
cord-266230-ia04jc9j	92	18	pseudorecombinant	pseudorecombinant	NN
cord-266230-ia04jc9j	92	19	consisting	consisting	NN
cord-266230-ia04jc9j	92	20	of	of	IN
cord-266230-ia04jc9j	92	21	heterologous	heterologous	NNP
cord-266230-ia04jc9j	92	22	3	3	NNP
cord-266230-ia04jc9j	92	23	'	'	POS
cord-266230-ia04jc9j	92	24	termini	termini	NNP
cord-266230-ia04jc9j	92	25	in	in	IN
cord-266230-ia04jc9j	92	26	RNA1	RNA1	NNP
cord-266230-ia04jc9j	92	27	and	and	CC
cord-266230-ia04jc9j	92	28	RNA2	RNA2	NNP
cord-266230-ia04jc9j	92	29	suggests	suggest	VBZ
cord-266230-ia04jc9j	92	30	that	that	IN
cord-266230-ia04jc9j	92	31	in	in	IN
cord-266230-ia04jc9j	92	32	this	this	DT
cord-266230-ia04jc9j	92	33	system	system	NN
cord-266230-ia04jc9j	92	34	precise	precise	JJ
cord-266230-ia04jc9j	92	35	3'terminal	3'terminal	CD
cord-266230-ia04jc9j	92	36	sequences	sequence	NNS
cord-266230-ia04jc9j	92	37	in	in	IN
cord-266230-ia04jc9j	92	38	RNA1	RNA1	NNP
cord-266230-ia04jc9j	92	39	and	and	CC
cord-266230-ia04jc9j	92	40	RNA2	RNA2	NNP
cord-266230-ia04jc9j	92	41	are	be	VBP
cord-266230-ia04jc9j	92	42	not	not	RB
cord-266230-ia04jc9j	92	43	essential	essential	JJ
cord-266230-ia04jc9j	92	44	for	for	IN
cord-266230-ia04jc9j	92	45	replication	replication	NN
cord-266230-ia04jc9j	92	46	.	.	.
cord-266230-ia04jc9j	93	1	It	-PRON-	PRP
cord-266230-ia04jc9j	93	2	has	have	VBZ
cord-266230-ia04jc9j	93	3	been	be	VBN
cord-266230-ia04jc9j	93	4	suggested	suggest	VBN
cord-266230-ia04jc9j	93	5	that	that	IN
cord-266230-ia04jc9j	93	6	the	the	DT
cord-266230-ia04jc9j	93	7	high	high	JJ
cord-266230-ia04jc9j	93	8	frequency	frequency	NN
cord-266230-ia04jc9j	93	9	of	of	IN
cord-266230-ia04jc9j	93	10	homologous	homologous	JJ
cord-266230-ia04jc9j	93	11	recombination	recombination	NN
cord-266230-ia04jc9j	93	12	in	in	IN
cord-266230-ia04jc9j	93	13	the	the	DT
cord-266230-ia04jc9j	93	14	animal	animal	NN
cord-266230-ia04jc9j	93	15	picornaviruses	picornavirus	NNS
cord-266230-ia04jc9j	93	16	is	be	VBZ
cord-266230-ia04jc9j	93	17	important	important	JJ
cord-266230-ia04jc9j	93	18	for	for	IN
cord-266230-ia04jc9j	93	19	removing	remove	VBG
cord-266230-ia04jc9j	93	20	deleterious	deleterious	JJ
cord-266230-ia04jc9j	93	21	mutations	mutation	NNS
cord-266230-ia04jc9j	93	22	introduced	introduce	VBN
cord-266230-ia04jc9j	93	23	by	by	IN
cord-266230-ia04jc9j	93	24	the	the	DT
cord-266230-ia04jc9j	93	25	poor	poor	JJ
cord-266230-ia04jc9j	93	26	fidelity	fidelity	NN
cord-266230-ia04jc9j	93	27	of	of	IN
cord-266230-ia04jc9j	93	28	the	the	DT
cord-266230-ia04jc9j	93	29	RNA	RNA	NNP
cord-266230-ia04jc9j	93	30	replicase	replicase	NN
cord-266230-ia04jc9j	93	31	(	(	-LRB-
cord-266230-ia04jc9j	93	32	22	22	CD
cord-266230-ia04jc9j	93	33	)	)	-RRB-
cord-266230-ia04jc9j	93	34	.	.	.
cord-266230-ia04jc9j	94	1	Since	since	IN
cord-266230-ia04jc9j	94	2	it	-PRON-	PRP
cord-266230-ia04jc9j	94	3	has	have	VBZ
cord-266230-ia04jc9j	94	4	been	be	VBN
cord-266230-ia04jc9j	94	5	suggested	suggest	VBN
cord-266230-ia04jc9j	94	6	that	that	IN
cord-266230-ia04jc9j	94	7	the	the	DT
cord-266230-ia04jc9j	94	8	picornavirus	picornavirus	NNP
cord-266230-ia04jc9j	94	9	replicative	replicative	JJ
cord-266230-ia04jc9j	94	10	machinery	machinery	NN
cord-266230-ia04jc9j	94	11	may	may	MD
cord-266230-ia04jc9j	94	12	not	not	RB
cord-266230-ia04jc9j	94	13	function	function	VB
cord-266230-ia04jc9j	94	14	efficiently	efficiently	RB
cord-266230-ia04jc9j	94	15	in	in	IN
cord-266230-ia04jc9j	94	16	trans	trans	NNP
cord-266230-ia04jc9j	94	17	,	,	,
cord-266230-ia04jc9j	94	18	nondefective	nondefective	JJ
cord-266230-ia04jc9j	94	19	genes	gene	NNS
cord-266230-ia04jc9j	94	20	,	,	,
cord-266230-ia04jc9j	94	21	located	locate	VBN
cord-266230-ia04jc9j	94	22	on	on	IN
cord-266230-ia04jc9j	94	23	different	different	JJ
cord-266230-ia04jc9j	94	24	RNA	RNA	NNP
cord-266230-ia04jc9j	94	25	molecules	molecule	NNS
cord-266230-ia04jc9j	94	26	which	which	WDT
cord-266230-ia04jc9j	94	27	possess	possess	VBP
cord-266230-ia04jc9j	94	28	errors	error	NNS
cord-266230-ia04jc9j	94	29	in	in	IN
cord-266230-ia04jc9j	94	30	genes	gene	NNS
cord-266230-ia04jc9j	94	31	involved	involve	VBN
cord-266230-ia04jc9j	94	32	in	in	IN
cord-266230-ia04jc9j	94	33	replication	replication	NN
cord-266230-ia04jc9j	94	34	,	,	,
cord-266230-ia04jc9j	94	35	can	can	MD
cord-266230-ia04jc9j	94	36	only	only	RB
cord-266230-ia04jc9j	94	37	be	be	VB
cord-266230-ia04jc9j	94	38	utilized	utilize	VBN
cord-266230-ia04jc9j	94	39	after	after	IN
cord-266230-ia04jc9j	94	40	genetic	genetic	JJ
cord-266230-ia04jc9j	94	41	recombination	recombination	NN
cord-266230-ia04jc9j	94	42	with	with	IN
cord-266230-ia04jc9j	94	43	an	an	DT
cord-266230-ia04jc9j	94	44	RNA	RNA	NNP
cord-266230-ia04jc9j	94	45	molecule	molecule	NN
cord-266230-ia04jc9j	94	46	which	which	WDT
cord-266230-ia04jc9j	94	47	encodes	encode	VBZ
cord-266230-ia04jc9j	94	48	functional	functional	JJ
cord-266230-ia04jc9j	94	49	replicative	replicative	JJ
cord-266230-ia04jc9j	94	50	genes	gene	NNS
cord-266230-ia04jc9j	94	51	(	(	-LRB-
cord-266230-ia04jc9j	94	52	23	23	CD
cord-266230-ia04jc9j	94	53	,	,	,
cord-266230-ia04jc9j	94	54	24	24	CD
cord-266230-ia04jc9j	94	55	)	)	-RRB-
cord-266230-ia04jc9j	94	56	.	.	.
cord-266230-ia04jc9j	95	1	It	-PRON-	PRP
cord-266230-ia04jc9j	95	2	is	be	VBZ
cord-266230-ia04jc9j	95	3	possible	possible	JJ
cord-266230-ia04jc9j	95	4	that	that	IN
cord-266230-ia04jc9j	95	5	,	,	,
cord-266230-ia04jc9j	95	6	in	in	IN
cord-266230-ia04jc9j	95	7	TomRSV	TomRSV	NNP
cord-266230-ia04jc9j	95	8	,	,	,
cord-266230-ia04jc9j	95	9	replication	replication	NN
cord-266230-ia04jc9j	95	10	begins	begin	VBZ
cord-266230-ia04jc9j	95	11	in	in	IN
cord-266230-ia04jc9j	95	12	cis	cis	NNP
cord-266230-ia04jc9j	95	13	with	with	IN
cord-266230-ia04jc9j	95	14	RNA1	RNA1	NNP
cord-266230-ia04jc9j	95	15	and	and	CC
cord-266230-ia04jc9j	95	16	that	that	IN
cord-266230-ia04jc9j	95	17	vans	van	NNS
cord-266230-ia04jc9j	95	18	replication	replication	NN
cord-266230-ia04jc9j	95	19	of	of	IN
cord-266230-ia04jc9j	95	20	RNA2	RNA2	NNP
cord-266230-ia04jc9j	95	21	occurs	occur	VBZ
cord-266230-ia04jc9j	95	22	only	only	RB
cord-266230-ia04jc9j	95	23	following	follow	VBG
cord-266230-ia04jc9j	95	24	disassociation	disassociation	NN
cord-266230-ia04jc9j	95	25	and	and	CC
cord-266230-ia04jc9j	95	26	reassociation	reassociation	NN
cord-266230-ia04jc9j	95	27	of	of	IN
cord-266230-ia04jc9j	95	28	the	the	DT
cord-266230-ia04jc9j	95	29	initial	initial	JJ
cord-266230-ia04jc9j	95	30	negative	negative	JJ
cord-266230-ia04jc9j	95	31	-	-	HYPH
cord-266230-ia04jc9j	95	32	strand	strand	NN
cord-266230-ia04jc9j	95	33	transcript	transcript	NN
cord-266230-ia04jc9j	95	34	with	with	IN
cord-266230-ia04jc9j	95	35	the	the	DT
cord-266230-ia04jc9j	95	36	corresponding	correspond	VBG
cord-266230-ia04jc9j	95	37	region	region	NN
cord-266230-ia04jc9j	95	38	in	in	IN
cord-266230-ia04jc9j	95	39	RNA2	RNA2	NNP
cord-266230-ia04jc9j	95	40	.	.	.
cord-266230-ia04jc9j	96	1	A	a	DT
cord-266230-ia04jc9j	96	2	similar	similar	JJ
cord-266230-ia04jc9j	96	3	mechanism	mechanism	NN
cord-266230-ia04jc9j	96	4	involving	involve	VBG
cord-266230-ia04jc9j	96	5	recombination	recombination	NN
cord-266230-ia04jc9j	96	6	could	could	MD
cord-266230-ia04jc9j	96	7	account	account	VB
cord-266230-ia04jc9j	96	8	for	for	IN
cord-266230-ia04jc9j	96	9	the	the	DT
cord-266230-ia04jc9j	96	10	sequence	sequence	NN
cord-266230-ia04jc9j	96	11	conservation	conservation	NN
cord-266230-ia04jc9j	96	12	observed	observe	VBN
cord-266230-ia04jc9j	96	13	between	between	IN
cord-266230-ia04jc9j	96	14	the	the	DT
cord-266230-ia04jc9j	96	15	5	5	CD
cord-266230-ia04jc9j	96	16	'	'	''
cord-266230-ia04jc9j	96	17	termini	termini	NNP
cord-266230-ia04jc9j	96	18	of	of	IN
cord-266230-ia04jc9j	96	19	RNA1	RNA1	NNP
cord-266230-ia04jc9j	96	20	and	and	CC
cord-266230-ia04jc9j	96	21	RNA2	RNA2	NNP
cord-266230-ia04jc9j	96	22	.	.	.
cord-266230-ia04jc9j	97	1	Such	such	JJ
cord-266230-ia04jc9j	97	2	a	a	DT
cord-266230-ia04jc9j	97	3	mechanism	mechanism	NN
cord-266230-ia04jc9j	97	4	has	have	VBZ
cord-266230-ia04jc9j	97	5	recently	recently	RB
cord-266230-ia04jc9j	97	6	been	be	VBN
cord-266230-ia04jc9j	97	7	proposed	propose	VBN
cord-266230-ia04jc9j	97	8	for	for	IN
cord-266230-ia04jc9j	97	9	leader	leader	NN
cord-266230-ia04jc9j	97	10	-	-	HYPH
cord-266230-ia04jc9j	97	11	primed	prime	VBN
cord-266230-ia04jc9j	97	12	generation	generation	NN
cord-266230-ia04jc9j	97	13	of	of	IN
cord-266230-ia04jc9j	97	14	subgenomic	subgenomic	NNP
cord-266230-ia04jc9j	97	15	RNAs	RNAs	NNPS
cord-266230-ia04jc9j	97	16	in	in	IN
cord-266230-ia04jc9j	97	17	coronaviruses	coronaviruse	NNS
cord-266230-ia04jc9j	97	18	(	(	-LRB-
cord-266230-ia04jc9j	97	19	see	see	VB
cord-266230-ia04jc9j	97	20	7	7	CD
cord-266230-ia04jc9j	97	21	)	)	-RRB-
cord-266230-ia04jc9j	97	22	.	.	.
cord-266230-ia04jc9j	98	1	The	the	DT
cord-266230-ia04jc9j	98	2	size	size	NN
cord-266230-ia04jc9j	98	3	of	of	IN
cord-266230-ia04jc9j	98	4	the	the	DT
cord-266230-ia04jc9j	98	5	duplicated	duplicate	VBN
cord-266230-ia04jc9j	98	6	sequences	sequence	NNS
cord-266230-ia04jc9j	98	7	in	in	IN
cord-266230-ia04jc9j	98	8	TomRSV	TomRSV	NNP
cord-266230-ia04jc9j	98	9	may	may	MD
cord-266230-ia04jc9j	98	10	be	be	VB
cord-266230-ia04jc9j	98	11	the	the	DT
cord-266230-ia04jc9j	98	12	minimum	minimum	NN
cord-266230-ia04jc9j	98	13	required	require	VBN
cord-266230-ia04jc9j	98	14	to	to	TO
cord-266230-ia04jc9j	98	15	facilitate	facilitate	VB
cord-266230-ia04jc9j	98	16	efficient	efficient	JJ
cord-266230-ia04jc9j	98	17	replication	replication	NN
cord-266230-ia04jc9j	98	18	through	through	IN
cord-266230-ia04jc9j	98	19	RNA	RNA	NNP
cord-266230-ia04jc9j	98	20	recombination	recombination	NN
cord-266230-ia04jc9j	98	21	between	between	IN
cord-266230-ia04jc9j	98	22	RNA1	RNA1	NNP
cord-266230-ia04jc9j	98	23	and	and	CC
cord-266230-ia04jc9j	98	24	RNA2	RNA2	NNP
cord-266230-ia04jc9j	98	25	.	.	.
cord-266230-ia04jc9j	99	1	Alternatively	alternatively	RB
cord-266230-ia04jc9j	99	2	,	,	,
cord-266230-ia04jc9j	99	3	the	the	DT
cord-266230-ia04jc9j	99	4	entire	entire	JJ
cord-266230-ia04jc9j	99	5	length	length	NN
cord-266230-ia04jc9j	99	6	may	may	MD
cord-266230-ia04jc9j	99	7	not	not	RB
cord-266230-ia04jc9j	99	8	be	be	VB
cord-266230-ia04jc9j	99	9	required	require	VBN
cord-266230-ia04jc9j	99	10	for	for	IN
cord-266230-ia04jc9j	99	11	recombination	recombination	NN
cord-266230-ia04jc9j	99	12	but	but	CC
cord-266230-ia04jc9j	99	13	may	may	MD
cord-266230-ia04jc9j	99	14	serve	serve	VB
cord-266230-ia04jc9j	99	15	other	other	JJ
cord-266230-ia04jc9j	99	16	important	important	JJ
cord-266230-ia04jc9j	99	17	functions	function	NNS
cord-266230-ia04jc9j	99	18	in	in	IN
cord-266230-ia04jc9j	99	19	addition	addition	NN
cord-266230-ia04jc9j	99	20	to	to	IN
cord-266230-ia04jc9j	99	21	a	a	DT
cord-266230-ia04jc9j	99	22	postulated	postulate	VBN
cord-266230-ia04jc9j	99	23	role	role	NN
cord-266230-ia04jc9j	99	24	in	in	IN
cord-266230-ia04jc9j	99	25	recombination	recombination	NN
cord-266230-ia04jc9j	99	26	.	.	.
cord-266230-ia04jc9j	100	1	We	-PRON-	PRP
cord-266230-ia04jc9j	100	2	are	be	VBP
cord-266230-ia04jc9j	100	3	planning	plan	VBG
cord-266230-ia04jc9j	100	4	further	further	JJ
cord-266230-ia04jc9j	100	5	experiments	experiment	NNS
cord-266230-ia04jc9j	100	6	to	to	TO
cord-266230-ia04jc9j	100	7	determine	determine	VB
cord-266230-ia04jc9j	100	8	the	the	DT
cord-266230-ia04jc9j	100	9	biological	biological	JJ
cord-266230-ia04jc9j	100	10	significance	significance	NN
cord-266230-ia04jc9j	100	11	of	of	IN
cord-266230-ia04jc9j	100	12	the	the	DT
cord-266230-ia04jc9j	100	13	repeated	repeat	VBN
cord-266230-ia04jc9j	100	14	sequences	sequence	NNS
cord-266230-ia04jc9j	100	15	between	between	IN
cord-266230-ia04jc9j	100	16	TomRSV	TomRSV	NNP
cord-266230-ia04jc9j	100	17	RNA1	RNA1	NNP
cord-266230-ia04jc9j	100	18	and	and	CC
cord-266230-ia04jc9j	100	19	RNA2	RNA2	NNP
cord-266230-ia04jc9j	100	20	and	and	CC
cord-266230-ia04jc9j	100	21	whether	whether	IN
cord-266230-ia04jc9j	100	22	they	-PRON-	PRP
cord-266230-ia04jc9j	100	23	are	be	VBP
cord-266230-ia04jc9j	100	24	in	in	IN
cord-266230-ia04jc9j	100	25	fact	fact	NN
cord-266230-ia04jc9j	100	26	involved	involve	VBN
cord-266230-ia04jc9j	100	27	in	in	IN
cord-266230-ia04jc9j	100	28	RNA	RNA	NNP
cord-266230-ia04jc9j	100	29	recombination	recombination	NN
cord-266230-ia04jc9j	100	30	during	during	IN
cord-266230-ia04jc9j	100	31	replication	replication	NN
cord-266230-ia04jc9j	100	32	.	.	.
cord-266230-ia04jc9j	101	1	The	the	DT
cord-266230-ia04jc9j	101	2	technical	technical	JJ
cord-266230-ia04jc9j	101	3	assistance	assistance	NN
cord-266230-ia04jc9j	101	4	of	of	IN
cord-266230-ia04jc9j	101	5	L.	L.	NNP
cord-266230-ia04jc9j	101	6	Lee	Lee	NNP
cord-266230-ia04jc9j	101	7	is	be	VBZ
cord-266230-ia04jc9j	101	8	gratefully	gratefully	RB
cord-266230-ia04jc9j	101	9	acknowledged	acknowledge	VBN
cord-266230-ia04jc9j	101	10	.	.	.
cord-266230-ia04jc9j	102	1	This	this	DT
cord-266230-ia04jc9j	102	2	work	work	NN
cord-266230-ia04jc9j	102	3	was	be	VBD
cord-266230-ia04jc9j	102	4	partially	partially	RB
cord-266230-ia04jc9j	102	5	supported	support	VBN
cord-266230-ia04jc9j	102	6	by	by	IN
cord-266230-ia04jc9j	102	7	an	an	DT
cord-266230-ia04jc9j	102	8	NSERC	NSERC	NNP
cord-266230-ia04jc9j	102	9	operating	operate	VBG
cord-266230-ia04jc9j	102	10	grant	grant	NN
cord-266230-ia04jc9j	102	11	awarded	award	VBN
cord-266230-ia04jc9j	102	12	to	to	IN
cord-266230-ia04jc9j	102	13	J.	J.	NNP
cord-266230-ia04jc9j	102	14	H.	H.	NNP
cord-266230-ia04jc9j	102	15	Tremaine	Tremaine	NNP
cord-266230-ia04jc9j	102	16	.	.	.
cord-266230-ia04jc9j	103	1	/n	/n	NNP
cord-266230-ia04jc9j	104	1	"	"	``
cord-266230-ia04jc9j	104	2	The	the	DT
cord-266230-ia04jc9j	104	3	Molecular	Molecular	NNP
cord-266230-ia04jc9j	104	4	Biology	Biology	NNP
cord-266230-ia04jc9j	104	5	of	of	IN
cord-266230-ia04jc9j	104	6	the	the	DT
cord-266230-ia04jc9j	104	7	Positive	Positive	NNP
cord-266230-ia04jc9j	104	8	Strand	Strand	NNP
cord-266230-ia04jc9j	104	9	RNA	RNA	NNP
cord-266230-ia04jc9j	104	10	Viruses	Viruses	NNPS
cord-266230-ia04jc9j	104	11	Cold	Cold	NNP
cord-266230-ia04jc9j	104	12	Spring	Spring	NNP
cord-266230-ia04jc9j	104	13	Harbor	Harbor	NNP
cord-266230-ia04jc9j	104	14	Symp	Symp	NNP
cord-266230-ia04jc9j	104	15	.	.	.
cord-266230-ia04jc9j	105	1	Quart	Quart	NNP
cord-266230-ia04jc9j	105	2	Biol	Biol	NNP
cord-266230-ia04jc9j	105	3	Descriptions	description	NNS
cord-266230-ia04jc9j	105	4	of	of	IN
cord-266230-ia04jc9j	105	5	Plant	Plant	NNP
cord-266230-ia04jc9j	105	6	Viruses	virus	NNS
cord-266230-ia04jc9j	105	7	Nematode	Nematode	NNP
cord-266230-ia04jc9j	105	8	Vectors	Vectors	NNPS
cord-266230-ia04jc9j	105	9	of	of	IN
cord-266230-ia04jc9j	105	10	Plant	Plant	NNP
cord-266230-ia04jc9j	105	11	Viruses	virus	NNS
cord-266230-ia04jc9j	106	1	V///rh	v///rh	RB
cord-266230-ia04jc9j	106	2	hf	hf	NNP