id	sid	tid	token	lemma	pos
cord-002410-2zi5iv2t	1	1	key	key	JJ
cord-002410-2zi5iv2t	2	1	:	:	:
cord-002410-2zi5iv2t	2	2	cord-002410	cord-002410	NNP
cord-002410-2zi5iv2t	2	3	-	-	HYPH
cord-002410-2zi5iv2t	2	4	2zi5iv2	2zi5iv2	CD
cord-002410-2zi5iv2t	2	5	t	t	NN
cord-002410-2zi5iv2t	2	6	authors	author	NNS
cord-002410-2zi5iv2t	2	7	:	:	:
cord-002410-2zi5iv2t	2	8	Bruening	Bruening	NNP
cord-002410-2zi5iv2t	2	9	,	,	,
cord-002410-2zi5iv2t	2	10	Janina	Janina	NNP
cord-002410-2zi5iv2t	2	11	;	;	:
cord-002410-2zi5iv2t	2	12	Weigel	Weigel	NNP
cord-002410-2zi5iv2t	2	13	,	,	,
cord-002410-2zi5iv2t	2	14	Bettina	Bettina	NNP
cord-002410-2zi5iv2t	2	15	;	;	:
cord-002410-2zi5iv2t	2	16	Gerold	Gerold	NNP
cord-002410-2zi5iv2t	2	17	,	,	,
cord-002410-2zi5iv2t	3	1	Gisa	Gisa	NNP
cord-002410-2zi5iv2t	3	2	title	title	NN
cord-002410-2zi5iv2t	3	3	:	:	:
cord-002410-2zi5iv2t	4	1	The	the	DT
cord-002410-2zi5iv2t	4	2	Role	role	NN
cord-002410-2zi5iv2t	4	3	of	of	IN
cord-002410-2zi5iv2t	4	4	Type	Type	NNP
cord-002410-2zi5iv2t	4	5	III	III	NNP
cord-002410-2zi5iv2t	4	6	Interferons	Interferons	NNPS
cord-002410-2zi5iv2t	4	7	in	in	IN
cord-002410-2zi5iv2t	4	8	Hepatitis	Hepatitis	NNP
cord-002410-2zi5iv2t	4	9	C	C	NNP
cord-002410-2zi5iv2t	4	10	Virus	virus	NN
cord-002410-2zi5iv2t	4	11	Infection	infection	NN
cord-002410-2zi5iv2t	4	12	and	and	CC
cord-002410-2zi5iv2t	4	13	Therapy	Therapy	NNP
cord-002410-2zi5iv2t	4	14	date	date	NN
cord-002410-2zi5iv2t	4	15	:	:	:
cord-002410-2zi5iv2t	4	16	2017	2017	CD
cord-002410-2zi5iv2t	4	17	-	-	HYPH
cord-002410-2zi5iv2t	4	18	02	02	CD
cord-002410-2zi5iv2t	4	19	-	-	HYPH
cord-002410-2zi5iv2t	4	20	01	01	CD
cord-002410-2zi5iv2t	4	21	journal	journal	NN
cord-002410-2zi5iv2t	4	22	:	:	:
cord-002410-2zi5iv2t	4	23	J	J	NNP
cord-002410-2zi5iv2t	4	24	Immunol	Immunol	NNP
cord-002410-2zi5iv2t	4	25	Res	Res	HYPH
cord-002410-2zi5iv2t	4	26	DOI	doi	NN
cord-002410-2zi5iv2t	4	27	:	:	:
cord-002410-2zi5iv2t	4	28	10.1155/2017/7232361	10.1155/2017/7232361	NNP
cord-002410-2zi5iv2t	4	29	sha	sha	NNP
cord-002410-2zi5iv2t	4	30	:	:	:
cord-002410-2zi5iv2t	4	31	71788152b25d71db652985de1cc4fb0513873969	71788152b25d71db652985de1cc4fb0513873969	CD
cord-002410-2zi5iv2t	4	32	doc_id	doc_id	CD
cord-002410-2zi5iv2t	4	33	:	:	:
cord-002410-2zi5iv2t	4	34	2410	2410	CD
cord-002410-2zi5iv2t	4	35	cord_uid	cord_uid	FW
cord-002410-2zi5iv2t	4	36	:	:	:
cord-002410-2zi5iv2t	5	1	2zi5iv2	2zi5iv2	NNP
cord-002410-2zi5iv2t	5	2	t	t	NNP
cord-002410-2zi5iv2t	6	1	The	the	DT
cord-002410-2zi5iv2t	6	2	human	human	JJ
cord-002410-2zi5iv2t	6	3	interferon	interferon	NN
cord-002410-2zi5iv2t	6	4	(	(	-LRB-
cord-002410-2zi5iv2t	6	5	IFN	IFN	NNP
cord-002410-2zi5iv2t	6	6	)	)	-RRB-
cord-002410-2zi5iv2t	6	7	response	response	NN
cord-002410-2zi5iv2t	6	8	is	be	VBZ
cord-002410-2zi5iv2t	6	9	a	a	DT
cord-002410-2zi5iv2t	6	10	key	key	JJ
cord-002410-2zi5iv2t	6	11	innate	innate	JJ
cord-002410-2zi5iv2t	6	12	immune	immune	JJ
cord-002410-2zi5iv2t	6	13	mechanism	mechanism	NN
cord-002410-2zi5iv2t	6	14	to	to	TO
cord-002410-2zi5iv2t	6	15	fight	fight	VB
cord-002410-2zi5iv2t	6	16	virus	virus	NN
cord-002410-2zi5iv2t	6	17	infection	infection	NN
cord-002410-2zi5iv2t	6	18	.	.	.
cord-002410-2zi5iv2t	7	1	IFNs	IFNs	NNP
cord-002410-2zi5iv2t	7	2	are	be	VBP
cord-002410-2zi5iv2t	7	3	host	host	NN
cord-002410-2zi5iv2t	7	4	-	-	HYPH
cord-002410-2zi5iv2t	7	5	encoded	encode	VBN
cord-002410-2zi5iv2t	7	6	secreted	secrete	VBN
cord-002410-2zi5iv2t	7	7	proteins	protein	NNS
cord-002410-2zi5iv2t	7	8	,	,	,
cord-002410-2zi5iv2t	7	9	which	which	WDT
cord-002410-2zi5iv2t	7	10	induce	induce	VBP
cord-002410-2zi5iv2t	7	11	IFN	IFN	NNP
cord-002410-2zi5iv2t	7	12	-	-	HYPH
cord-002410-2zi5iv2t	7	13	stimulated	stimulate	VBN
cord-002410-2zi5iv2t	7	14	genes	gene	NNS
cord-002410-2zi5iv2t	7	15	(	(	-LRB-
cord-002410-2zi5iv2t	7	16	ISGs	ISGs	NNP
cord-002410-2zi5iv2t	7	17	)	)	-RRB-
cord-002410-2zi5iv2t	7	18	with	with	IN
cord-002410-2zi5iv2t	7	19	antiviral	antiviral	JJ
cord-002410-2zi5iv2t	7	20	properties	property	NNS
cord-002410-2zi5iv2t	7	21	.	.	.
cord-002410-2zi5iv2t	8	1	Among	among	IN
cord-002410-2zi5iv2t	8	2	the	the	DT
cord-002410-2zi5iv2t	8	3	three	three	CD
cord-002410-2zi5iv2t	8	4	classes	class	NNS
cord-002410-2zi5iv2t	8	5	of	of	IN
cord-002410-2zi5iv2t	8	6	IFNs	ifn	NNS
cord-002410-2zi5iv2t	8	7	,	,	,
cord-002410-2zi5iv2t	8	8	type	type	NN
cord-002410-2zi5iv2t	8	9	III	iii	CD
cord-002410-2zi5iv2t	8	10	IFNs	ifn	NNS
cord-002410-2zi5iv2t	8	11	,	,	,
cord-002410-2zi5iv2t	8	12	also	also	RB
cord-002410-2zi5iv2t	8	13	called	call	VBN
cord-002410-2zi5iv2t	8	14	IFN	IFN	NNP
cord-002410-2zi5iv2t	8	15	lambdas	lambda	NNS
cord-002410-2zi5iv2t	8	16	(	(	-LRB-
cord-002410-2zi5iv2t	8	17	IFNLs	IFNLs	NNP
cord-002410-2zi5iv2t	8	18	)	)	-RRB-
cord-002410-2zi5iv2t	8	19	,	,	,
cord-002410-2zi5iv2t	8	20	are	be	VBP
cord-002410-2zi5iv2t	8	21	an	an	DT
cord-002410-2zi5iv2t	8	22	essential	essential	JJ
cord-002410-2zi5iv2t	8	23	component	component	NN
cord-002410-2zi5iv2t	8	24	of	of	IN
cord-002410-2zi5iv2t	8	25	the	the	DT
cord-002410-2zi5iv2t	8	26	innate	innate	JJ
cord-002410-2zi5iv2t	8	27	immune	immune	JJ
cord-002410-2zi5iv2t	8	28	response	response	NN
cord-002410-2zi5iv2t	8	29	to	to	IN
cord-002410-2zi5iv2t	8	30	hepatitis	hepatitis	NNP
cord-002410-2zi5iv2t	8	31	C	C	NNP
cord-002410-2zi5iv2t	8	32	virus	virus	NN
cord-002410-2zi5iv2t	8	33	(	(	-LRB-
cord-002410-2zi5iv2t	8	34	HCV	HCV	NNP
cord-002410-2zi5iv2t	8	35	)	)	-RRB-
cord-002410-2zi5iv2t	8	36	.	.	.
cord-002410-2zi5iv2t	9	1	In	in	IN
cord-002410-2zi5iv2t	9	2	particular	particular	JJ
cord-002410-2zi5iv2t	9	3	,	,	,
cord-002410-2zi5iv2t	9	4	human	human	JJ
cord-002410-2zi5iv2t	9	5	polymorphisms	polymorphism	NNS
cord-002410-2zi5iv2t	9	6	in	in	IN
cord-002410-2zi5iv2t	9	7	IFNL	IFNL	NNP
cord-002410-2zi5iv2t	9	8	gene	gene	NN
cord-002410-2zi5iv2t	9	9	loci	locus	NNS
cord-002410-2zi5iv2t	9	10	correlate	correlate	VBP
cord-002410-2zi5iv2t	9	11	with	with	IN
cord-002410-2zi5iv2t	9	12	hepatitis	hepatitis	NN
cord-002410-2zi5iv2t	9	13	C	C	NNP
cord-002410-2zi5iv2t	9	14	disease	disease	NN
cord-002410-2zi5iv2t	9	15	progression	progression	NN
cord-002410-2zi5iv2t	9	16	and	and	CC
cord-002410-2zi5iv2t	9	17	with	with	IN
cord-002410-2zi5iv2t	9	18	treatment	treatment	NN
cord-002410-2zi5iv2t	9	19	response	response	NN
cord-002410-2zi5iv2t	9	20	.	.	.
cord-002410-2zi5iv2t	10	1	To	to	IN
cord-002410-2zi5iv2t	10	2	date	date	NN
cord-002410-2zi5iv2t	10	3	,	,	,
cord-002410-2zi5iv2t	10	4	the	the	DT
cord-002410-2zi5iv2t	10	5	underlying	underlie	VBG
cord-002410-2zi5iv2t	10	6	mechanisms	mechanism	NNS
cord-002410-2zi5iv2t	10	7	remain	remain	VBP
cord-002410-2zi5iv2t	10	8	mostly	mostly	RB
cord-002410-2zi5iv2t	10	9	elusive	elusive	JJ
cord-002410-2zi5iv2t	10	10	;	;	:
cord-002410-2zi5iv2t	10	11	however	however	RB
cord-002410-2zi5iv2t	10	12	it	-PRON-	PRP
cord-002410-2zi5iv2t	10	13	seems	seem	VBZ
cord-002410-2zi5iv2t	10	14	clear	clear	JJ
cord-002410-2zi5iv2t	10	15	that	that	IN
cord-002410-2zi5iv2t	10	16	viral	viral	JJ
cord-002410-2zi5iv2t	10	17	infection	infection	NN
cord-002410-2zi5iv2t	10	18	of	of	IN
cord-002410-2zi5iv2t	10	19	the	the	DT
cord-002410-2zi5iv2t	10	20	liver	liver	NN
cord-002410-2zi5iv2t	10	21	induces	induce	VBZ
cord-002410-2zi5iv2t	10	22	IFNL	IFNL	NNP
cord-002410-2zi5iv2t	10	23	responses	response	NNS
cord-002410-2zi5iv2t	10	24	.	.	.
cord-002410-2zi5iv2t	11	1	As	as	IN
cord-002410-2zi5iv2t	11	2	IFNL	IFNL	NNP
cord-002410-2zi5iv2t	11	3	receptors	receptor	NNS
cord-002410-2zi5iv2t	11	4	show	show	VBP
cord-002410-2zi5iv2t	11	5	a	a	DT
cord-002410-2zi5iv2t	11	6	more	more	RBR
cord-002410-2zi5iv2t	11	7	restricted	restricted	JJ
cord-002410-2zi5iv2t	11	8	tissue	tissue	NN
cord-002410-2zi5iv2t	11	9	expression	expression	NN
cord-002410-2zi5iv2t	11	10	than	than	IN
cord-002410-2zi5iv2t	11	11	receptors	receptor	NNS
cord-002410-2zi5iv2t	11	12	for	for	IN
cord-002410-2zi5iv2t	11	13	other	other	JJ
cord-002410-2zi5iv2t	11	14	classes	class	NNS
cord-002410-2zi5iv2t	11	15	of	of	IN
cord-002410-2zi5iv2t	11	16	IFNs	ifn	NNS
cord-002410-2zi5iv2t	11	17	,	,	,
cord-002410-2zi5iv2t	11	18	IFNL	IFNL	NNP
cord-002410-2zi5iv2t	11	19	treatment	treatment	NN
cord-002410-2zi5iv2t	11	20	has	have	VBZ
cord-002410-2zi5iv2t	11	21	reduced	reduce	VBN
cord-002410-2zi5iv2t	11	22	side	side	NN
cord-002410-2zi5iv2t	11	23	effects	effect	NNS
cord-002410-2zi5iv2t	11	24	compared	compare	VBN
cord-002410-2zi5iv2t	11	25	to	to	IN
cord-002410-2zi5iv2t	11	26	the	the	DT
cord-002410-2zi5iv2t	11	27	classical	classical	JJ
cord-002410-2zi5iv2t	11	28	type	type	NN
cord-002410-2zi5iv2t	11	29	I	-PRON-	PRP
cord-002410-2zi5iv2t	11	30	IFN	IFN	NNP
cord-002410-2zi5iv2t	11	31	treatment	treatment	NN
cord-002410-2zi5iv2t	11	32	.	.	.
cord-002410-2zi5iv2t	12	1	In	in	IN
cord-002410-2zi5iv2t	12	2	HCV	HCV	NNP
cord-002410-2zi5iv2t	12	3	therapy	therapy	NN
cord-002410-2zi5iv2t	12	4	,	,	,
cord-002410-2zi5iv2t	12	5	however	however	RB
cord-002410-2zi5iv2t	12	6	,	,	,
cord-002410-2zi5iv2t	12	7	IFNL	IFNL	NNP
cord-002410-2zi5iv2t	12	8	will	will	MD
cord-002410-2zi5iv2t	12	9	likely	likely	RB
cord-002410-2zi5iv2t	12	10	not	not	RB
cord-002410-2zi5iv2t	12	11	play	play	VB
cord-002410-2zi5iv2t	12	12	an	an	DT
cord-002410-2zi5iv2t	12	13	important	important	JJ
cord-002410-2zi5iv2t	12	14	role	role	NN
cord-002410-2zi5iv2t	12	15	as	as	IN
cord-002410-2zi5iv2t	12	16	highly	highly	RB
cord-002410-2zi5iv2t	12	17	effective	effective	JJ
cord-002410-2zi5iv2t	12	18	direct	direct	JJ
cord-002410-2zi5iv2t	12	19	acting	acting	NN
cord-002410-2zi5iv2t	12	20	antivirals	antiviral	NNS
cord-002410-2zi5iv2t	12	21	(	(	-LRB-
cord-002410-2zi5iv2t	12	22	DAA	DAA	NNP
cord-002410-2zi5iv2t	12	23	)	)	-RRB-
cord-002410-2zi5iv2t	12	24	exist	exist	VBP
cord-002410-2zi5iv2t	12	25	.	.	.
cord-002410-2zi5iv2t	13	1	Here	here	RB
cord-002410-2zi5iv2t	13	2	,	,	,
cord-002410-2zi5iv2t	13	3	we	-PRON-	PRP
cord-002410-2zi5iv2t	13	4	will	will	MD
cord-002410-2zi5iv2t	13	5	review	review	VB
cord-002410-2zi5iv2t	13	6	our	-PRON-	PRP$
cord-002410-2zi5iv2t	13	7	current	current	JJ
cord-002410-2zi5iv2t	13	8	knowledge	knowledge	NN
cord-002410-2zi5iv2t	13	9	on	on	IN
cord-002410-2zi5iv2t	13	10	IFNL	IFNL	NNP
cord-002410-2zi5iv2t	13	11	gene	gene	NN
cord-002410-2zi5iv2t	13	12	expression	expression	NN
cord-002410-2zi5iv2t	13	13	,	,	,
cord-002410-2zi5iv2t	13	14	protein	protein	NN
cord-002410-2zi5iv2t	13	15	properties	property	NNS
cord-002410-2zi5iv2t	13	16	,	,	,
cord-002410-2zi5iv2t	13	17	signaling	signal	VBG
cord-002410-2zi5iv2t	13	18	,	,	,
cord-002410-2zi5iv2t	13	19	ISG	ISG	NNP
cord-002410-2zi5iv2t	13	20	induction	induction	NN
cord-002410-2zi5iv2t	13	21	,	,	,
cord-002410-2zi5iv2t	13	22	and	and	CC
cord-002410-2zi5iv2t	13	23	its	-PRON-	PRP$
cord-002410-2zi5iv2t	13	24	implications	implication	NNS
cord-002410-2zi5iv2t	13	25	on	on	IN
cord-002410-2zi5iv2t	13	26	HCV	HCV	NNP
cord-002410-2zi5iv2t	13	27	infection	infection	NN
cord-002410-2zi5iv2t	13	28	and	and	CC
cord-002410-2zi5iv2t	13	29	treatment	treatment	NN
cord-002410-2zi5iv2t	13	30	.	.	.
cord-002410-2zi5iv2t	14	1	Finally	finally	RB
cord-002410-2zi5iv2t	14	2	,	,	,
cord-002410-2zi5iv2t	14	3	we	-PRON-	PRP
cord-002410-2zi5iv2t	14	4	will	will	MD
cord-002410-2zi5iv2t	14	5	discuss	discuss	VB
cord-002410-2zi5iv2t	14	6	the	the	DT
cord-002410-2zi5iv2t	14	7	lessons	lesson	NNS
cord-002410-2zi5iv2t	14	8	learnt	learn	VBN
cord-002410-2zi5iv2t	14	9	from	from	IN
cord-002410-2zi5iv2t	14	10	the	the	DT
cord-002410-2zi5iv2t	14	11	HCV	HCV	NNP
cord-002410-2zi5iv2t	14	12	and	and	CC
cord-002410-2zi5iv2t	14	13	IFNL	IFNL	NNP
cord-002410-2zi5iv2t	14	14	field	field	NN
cord-002410-2zi5iv2t	14	15	for	for	IN
cord-002410-2zi5iv2t	14	16	virus	virus	NN
cord-002410-2zi5iv2t	14	17	infections	infection	NNS
cord-002410-2zi5iv2t	14	18	beyond	beyond	IN
cord-002410-2zi5iv2t	14	19	hepatitis	hepatitis	NN
cord-002410-2zi5iv2t	14	20	C.	C.	NNP
cord-002410-2zi5iv2t	14	21	Interferons	Interferons	NNP
cord-002410-2zi5iv2t	14	22	(	(	-LRB-
cord-002410-2zi5iv2t	14	23	IFN	IFN	NNP
cord-002410-2zi5iv2t	14	24	)	)	-RRB-
cord-002410-2zi5iv2t	14	25	are	be	VBP
cord-002410-2zi5iv2t	14	26	innate	innate	JJ
cord-002410-2zi5iv2t	14	27	cytokines	cytokine	NNS
cord-002410-2zi5iv2t	14	28	,	,	,
cord-002410-2zi5iv2t	14	29	which	which	WDT
cord-002410-2zi5iv2t	14	30	interfere	interfere	VBP
cord-002410-2zi5iv2t	14	31	with	with	IN
cord-002410-2zi5iv2t	14	32	virus	virus	NN
cord-002410-2zi5iv2t	14	33	infections	infection	NNS
cord-002410-2zi5iv2t	14	34	.	.	.
cord-002410-2zi5iv2t	15	1	While	while	IN
cord-002410-2zi5iv2t	15	2	type	type	NN
cord-002410-2zi5iv2t	15	3	I	-PRON-	PRP
cord-002410-2zi5iv2t	15	4	IFNs	ifn	NNS
cord-002410-2zi5iv2t	15	5	were	be	VBD
cord-002410-2zi5iv2t	15	6	discovered	discover	VBN
cord-002410-2zi5iv2t	15	7	in	in	IN
cord-002410-2zi5iv2t	15	8	the	the	DT
cord-002410-2zi5iv2t	15	9	1950s	1950	NNS
cord-002410-2zi5iv2t	15	10	,	,	,
cord-002410-2zi5iv2t	15	11	it	-PRON-	PRP
cord-002410-2zi5iv2t	15	12	was	be	VBD
cord-002410-2zi5iv2t	15	13	not	not	RB
cord-002410-2zi5iv2t	15	14	until	until	IN
cord-002410-2zi5iv2t	15	15	2003	2003	CD
cord-002410-2zi5iv2t	15	16	that	that	IN
cord-002410-2zi5iv2t	15	17	the	the	DT
cord-002410-2zi5iv2t	15	18	first	first	JJ
cord-002410-2zi5iv2t	15	19	type	type	NN
cord-002410-2zi5iv2t	15	20	III	iii	CD
cord-002410-2zi5iv2t	15	21	IFNs	ifn	NNS
cord-002410-2zi5iv2t	15	22	,	,	,
cord-002410-2zi5iv2t	15	23	namely	namely	RB
cord-002410-2zi5iv2t	15	24	,	,	,
cord-002410-2zi5iv2t	15	25	IFN	IFN	NNP
cord-002410-2zi5iv2t	15	26	lambda	lambda	NN
cord-002410-2zi5iv2t	15	27	1	1	CD
cord-002410-2zi5iv2t	15	28	(	(	-LRB-
cord-002410-2zi5iv2t	15	29	IFNL1	ifnl1	NN
cord-002410-2zi5iv2t	15	30	)	)	-RRB-
cord-002410-2zi5iv2t	15	31	,	,	,
cord-002410-2zi5iv2t	15	32	lambda	lambda	NN
cord-002410-2zi5iv2t	15	33	2	2	CD
cord-002410-2zi5iv2t	15	34	(	(	-LRB-
cord-002410-2zi5iv2t	15	35	IFNL2	IFNL2	NNP
cord-002410-2zi5iv2t	15	36	)	)	-RRB-
cord-002410-2zi5iv2t	15	37	,	,	,
cord-002410-2zi5iv2t	15	38	and	and	CC
cord-002410-2zi5iv2t	15	39	IFN	IFN	NNP
cord-002410-2zi5iv2t	15	40	lambda	lambda	NNP
cord-002410-2zi5iv2t	15	41	3	3	CD
cord-002410-2zi5iv2t	15	42	(	(	-LRB-
cord-002410-2zi5iv2t	15	43	IFNL3	IFNL3	NNP
cord-002410-2zi5iv2t	15	44	)	)	-RRB-
cord-002410-2zi5iv2t	15	45	,	,	,
cord-002410-2zi5iv2t	15	46	were	be	VBD
cord-002410-2zi5iv2t	15	47	described	describe	VBN
cord-002410-2zi5iv2t	15	48	[	[	-LRB-
cord-002410-2zi5iv2t	15	49	1	1	CD
cord-002410-2zi5iv2t	15	50	,	,	,
cord-002410-2zi5iv2t	15	51	2	2	CD
cord-002410-2zi5iv2t	15	52	]	]	-RRB-
cord-002410-2zi5iv2t	15	53	.	.	.
cord-002410-2zi5iv2t	16	1	The	the	DT
cord-002410-2zi5iv2t	16	2	most	most	RBS
cord-002410-2zi5iv2t	16	3	recent	recent	JJ
cord-002410-2zi5iv2t	16	4	member	member	NN
cord-002410-2zi5iv2t	16	5	of	of	IN
cord-002410-2zi5iv2t	16	6	the	the	DT
cord-002410-2zi5iv2t	16	7	type	type	NN
cord-002410-2zi5iv2t	16	8	III	iii	CD
cord-002410-2zi5iv2t	16	9	IFNs	ifn	NNS
cord-002410-2zi5iv2t	16	10	,	,	,
cord-002410-2zi5iv2t	16	11	IFN	IFN	NNP
cord-002410-2zi5iv2t	16	12	lambda	lambda	NN
cord-002410-2zi5iv2t	16	13	4	4	CD
cord-002410-2zi5iv2t	16	14	(	(	-LRB-
cord-002410-2zi5iv2t	16	15	IFNL4	IFNL4	NNP
cord-002410-2zi5iv2t	16	16	)	)	-RRB-
cord-002410-2zi5iv2t	16	17	,	,	,
cord-002410-2zi5iv2t	16	18	was	be	VBD
cord-002410-2zi5iv2t	16	19	discovered	discover	VBN
cord-002410-2zi5iv2t	16	20	even	even	RB
cord-002410-2zi5iv2t	16	21	ten	ten	CD
cord-002410-2zi5iv2t	16	22	years	year	NNS
cord-002410-2zi5iv2t	16	23	later	later	RB
cord-002410-2zi5iv2t	16	24	[	[	-LRB-
cord-002410-2zi5iv2t	16	25	3	3	CD
cord-002410-2zi5iv2t	16	26	,	,	,
cord-002410-2zi5iv2t	16	27	4	4	CD
cord-002410-2zi5iv2t	16	28	]	]	-RRB-
cord-002410-2zi5iv2t	16	29	.	.	.
cord-002410-2zi5iv2t	17	1	All	all	DT
cord-002410-2zi5iv2t	17	2	four	four	CD
cord-002410-2zi5iv2t	17	3	IFNLs	ifnl	NNS
cord-002410-2zi5iv2t	17	4	are	be	VBP
cord-002410-2zi5iv2t	17	5	encoded	encode	VBN
cord-002410-2zi5iv2t	17	6	on	on	IN
cord-002410-2zi5iv2t	17	7	chromosome	chromosome	NN
cord-002410-2zi5iv2t	17	8	9	9	CD
cord-002410-2zi5iv2t	17	9	in	in	IN
cord-002410-2zi5iv2t	17	10	the	the	DT
cord-002410-2zi5iv2t	17	11	19q13.13	19q13.13	CD
cord-002410-2zi5iv2t	17	12	region	region	NN
cord-002410-2zi5iv2t	17	13	.	.	.
cord-002410-2zi5iv2t	18	1	INFLs	INFLs	NNPS
cord-002410-2zi5iv2t	18	2	share	share	VBP
cord-002410-2zi5iv2t	18	3	their	-PRON-	PRP$
cord-002410-2zi5iv2t	18	4	open	open	JJ
cord-002410-2zi5iv2t	18	5	reading	reading	NN
cord-002410-2zi5iv2t	18	6	frame	frame	NN
cord-002410-2zi5iv2t	18	7	structure	structure	NN
cord-002410-2zi5iv2t	18	8	with	with	IN
cord-002410-2zi5iv2t	18	9	the	the	DT
cord-002410-2zi5iv2t	18	10	interleukin-10	interleukin-10	NN
cord-002410-2zi5iv2t	18	11	(	(	-LRB-
cord-002410-2zi5iv2t	18	12	IL-10	IL-10	NNP
cord-002410-2zi5iv2t	18	13	)	)	-RRB-
cord-002410-2zi5iv2t	18	14	family	family	NN
cord-002410-2zi5iv2t	18	15	of	of	IN
cord-002410-2zi5iv2t	18	16	cytokines	cytokine	NNS
cord-002410-2zi5iv2t	18	17	comprising	comprise	VBG
cord-002410-2zi5iv2t	18	18	five	five	CD
cord-002410-2zi5iv2t	18	19	exons	exon	NNS
cord-002410-2zi5iv2t	18	20	and	and	CC
cord-002410-2zi5iv2t	18	21	four	four	CD
cord-002410-2zi5iv2t	18	22	introns	intron	NNS
cord-002410-2zi5iv2t	18	23	[	[	-LRB-
cord-002410-2zi5iv2t	18	24	5	5	CD
cord-002410-2zi5iv2t	18	25	]	]	-RRB-
cord-002410-2zi5iv2t	18	26	[	[	-LRB-
cord-002410-2zi5iv2t	18	27	6	6	CD
cord-002410-2zi5iv2t	18	28	]	]	-RRB-
cord-002410-2zi5iv2t	18	29	[	[	-LRB-
cord-002410-2zi5iv2t	18	30	7	7	CD
cord-002410-2zi5iv2t	18	31	]	]	-RRB-
cord-002410-2zi5iv2t	18	32	.	.	.
cord-002410-2zi5iv2t	19	1	Therefore	therefore	RB
cord-002410-2zi5iv2t	19	2	,	,	,
cord-002410-2zi5iv2t	19	3	they	-PRON-	PRP
cord-002410-2zi5iv2t	19	4	are	be	VBP
cord-002410-2zi5iv2t	19	5	also	also	RB
cord-002410-2zi5iv2t	19	6	termed	term	VBN
cord-002410-2zi5iv2t	19	7	IL-29	IL-29	NNP
cord-002410-2zi5iv2t	19	8	(	(	-LRB-
cord-002410-2zi5iv2t	19	9	IFNL1	ifnl1	NN
cord-002410-2zi5iv2t	19	10	)	)	-RRB-
cord-002410-2zi5iv2t	19	11	,	,	,
cord-002410-2zi5iv2t	19	12	IL-28A	IL-28A	NNP
cord-002410-2zi5iv2t	19	13	(	(	-LRB-
cord-002410-2zi5iv2t	19	14	IFNL2	ifnl2	NN
cord-002410-2zi5iv2t	19	15	)	)	-RRB-
cord-002410-2zi5iv2t	19	16	,	,	,
cord-002410-2zi5iv2t	19	17	and	and	CC
cord-002410-2zi5iv2t	19	18	IL-28B	IL-28B	NNP
cord-002410-2zi5iv2t	19	19	(	(	-LRB-
cord-002410-2zi5iv2t	19	20	IFNL3	ifnl3	NN
cord-002410-2zi5iv2t	19	21	)	)	-RRB-
cord-002410-2zi5iv2t	19	22	.	.	.
cord-002410-2zi5iv2t	20	1	IFNL1	IFNL1	NNS
cord-002410-2zi5iv2t	20	2	through	through	IN
cord-002410-2zi5iv2t	20	3	IFNL3	IFNL3	NNS
cord-002410-2zi5iv2t	20	4	have	have	VBP
cord-002410-2zi5iv2t	20	5	a	a	DT
cord-002410-2zi5iv2t	20	6	high	high	JJ
cord-002410-2zi5iv2t	20	7	degree	degree	NN
cord-002410-2zi5iv2t	20	8	of	of	IN
cord-002410-2zi5iv2t	20	9	sequence	sequence	NN
cord-002410-2zi5iv2t	20	10	similarity	similarity	NN
cord-002410-2zi5iv2t	20	11	with	with	IN
cord-002410-2zi5iv2t	20	12	72	72	CD
cord-002410-2zi5iv2t	20	13	%	%	NN
cord-002410-2zi5iv2t	20	14	to	to	TO
cord-002410-2zi5iv2t	20	15	96	96	CD
cord-002410-2zi5iv2t	20	16	%	%	NN
cord-002410-2zi5iv2t	20	17	amino	amino	NN
cord-002410-2zi5iv2t	20	18	acid	acid	NN
cord-002410-2zi5iv2t	20	19	conservation	conservation	NN
cord-002410-2zi5iv2t	20	20	with	with	IN
cord-002410-2zi5iv2t	20	21	IFNL2	IFNL2	NNS
cord-002410-2zi5iv2t	20	22	and	and	CC
cord-002410-2zi5iv2t	20	23	IFNL3	ifnl3	NN
cord-002410-2zi5iv2t	20	24	being	be	VBG
cord-002410-2zi5iv2t	20	25	most	most	RBS
cord-002410-2zi5iv2t	20	26	closely	closely	RB
cord-002410-2zi5iv2t	20	27	related	relate	VBN
cord-002410-2zi5iv2t	20	28	.	.	.
cord-002410-2zi5iv2t	21	1	These	these	DT
cord-002410-2zi5iv2t	21	2	findings	finding	NNS
cord-002410-2zi5iv2t	21	3	suggest	suggest	VBP
cord-002410-2zi5iv2t	21	4	a	a	DT
cord-002410-2zi5iv2t	21	5	common	common	JJ
cord-002410-2zi5iv2t	21	6	ancestor	ancestor	NN
cord-002410-2zi5iv2t	21	7	gene	gene	NN
cord-002410-2zi5iv2t	21	8	for	for	IN
cord-002410-2zi5iv2t	21	9	all	all	DT
cord-002410-2zi5iv2t	21	10	IFNLs	ifnl	NNS
cord-002410-2zi5iv2t	21	11	[	[	-LRB-
cord-002410-2zi5iv2t	21	12	3	3	CD
cord-002410-2zi5iv2t	21	13	]	]	-RRB-
cord-002410-2zi5iv2t	21	14	.	.	.
cord-002410-2zi5iv2t	22	1	IFNL4	IFNL4	NNP
cord-002410-2zi5iv2t	22	2	expression	expression	NN
cord-002410-2zi5iv2t	22	3	is	be	VBZ
cord-002410-2zi5iv2t	22	4	the	the	DT
cord-002410-2zi5iv2t	22	5	consequence	consequence	NN
cord-002410-2zi5iv2t	22	6	of	of	IN
cord-002410-2zi5iv2t	22	7	a	a	DT
cord-002410-2zi5iv2t	22	8	frameshift	frameshift	NN
cord-002410-2zi5iv2t	22	9	mutation	mutation	NN
cord-002410-2zi5iv2t	22	10	and	and	CC
cord-002410-2zi5iv2t	22	11	this	this	DT
cord-002410-2zi5iv2t	22	12	gene	gene	NN
cord-002410-2zi5iv2t	22	13	product	product	NN
cord-002410-2zi5iv2t	22	14	shares	share	NNS
cord-002410-2zi5iv2t	22	15	27	27	CD
cord-002410-2zi5iv2t	22	16	%	%	NN
cord-002410-2zi5iv2t	22	17	to	to	TO
cord-002410-2zi5iv2t	22	18	29	29	CD
cord-002410-2zi5iv2t	22	19	%	%	NN
cord-002410-2zi5iv2t	22	20	sequence	sequence	NN
cord-002410-2zi5iv2t	22	21	similarity	similarity	NN
cord-002410-2zi5iv2t	22	22	with	with	IN
cord-002410-2zi5iv2t	22	23	the	the	DT
cord-002410-2zi5iv2t	22	24	other	other	JJ
cord-002410-2zi5iv2t	22	25	three	three	CD
cord-002410-2zi5iv2t	22	26	IFNLs	ifnl	NNS
cord-002410-2zi5iv2t	22	27	(	(	-LRB-
cord-002410-2zi5iv2t	22	28	Table	table	NN
cord-002410-2zi5iv2t	22	29	1	1	CD
cord-002410-2zi5iv2t	22	30	and	and	CC
cord-002410-2zi5iv2t	22	31	Figure	figure	NN
cord-002410-2zi5iv2t	22	32	1	1	CD
cord-002410-2zi5iv2t	22	33	)	)	-RRB-
cord-002410-2zi5iv2t	22	34	.	.	.
cord-002410-2zi5iv2t	23	1	IFNL1	ifnl1	NN
cord-002410-2zi5iv2t	23	2	-	-	SYM
cord-002410-2zi5iv2t	23	3	3	3	CD
cord-002410-2zi5iv2t	23	4	proteins	protein	NNS
cord-002410-2zi5iv2t	23	5	are	be	VBP
cord-002410-2zi5iv2t	23	6	roughly	roughly	RB
cord-002410-2zi5iv2t	23	7	22	22	CD
cord-002410-2zi5iv2t	23	8	kDa	kDa	NNS
cord-002410-2zi5iv2t	23	9	in	in	IN
cord-002410-2zi5iv2t	23	10	size	size	NN
cord-002410-2zi5iv2t	23	11	,	,	,
cord-002410-2zi5iv2t	23	12	while	while	IN
cord-002410-2zi5iv2t	23	13	IFNL4	IFNL4	NNP
cord-002410-2zi5iv2t	23	14	is	be	VBZ
cord-002410-2zi5iv2t	23	15	slightly	slightly	RB
cord-002410-2zi5iv2t	23	16	smaller	small	JJR
cord-002410-2zi5iv2t	23	17	with	with	IN
cord-002410-2zi5iv2t	23	18	20	20	CD
cord-002410-2zi5iv2t	23	19	kDa	kDa	NNS
cord-002410-2zi5iv2t	23	20	.	.	.
cord-002410-2zi5iv2t	24	1	They	-PRON-	PRP
cord-002410-2zi5iv2t	24	2	share	share	VBP
cord-002410-2zi5iv2t	24	3	an	an	DT
cord-002410-2zi5iv2t	24	4	alpha	alpha	NN
cord-002410-2zi5iv2t	24	5	helical	helical	JJ
cord-002410-2zi5iv2t	24	6	bundle	bundle	NN
cord-002410-2zi5iv2t	24	7	structure	structure	NN
cord-002410-2zi5iv2t	24	8	with	with	IN
cord-002410-2zi5iv2t	24	9	type	type	NN
cord-002410-2zi5iv2t	24	10	I	-PRON-	PRP
cord-002410-2zi5iv2t	24	11	and	and	CC
cord-002410-2zi5iv2t	24	12	type	type	NN
cord-002410-2zi5iv2t	24	13	II	II	NNP
cord-002410-2zi5iv2t	24	14	IFN	IFN	NNP
cord-002410-2zi5iv2t	24	15	family	family	NN
cord-002410-2zi5iv2t	24	16	members	member	NNS
cord-002410-2zi5iv2t	24	17	.	.	.
cord-002410-2zi5iv2t	25	1	Significant	significant	JJ
cord-002410-2zi5iv2t	25	2	differences	difference	NNS
cord-002410-2zi5iv2t	25	3	occur	occur	VBP
cord-002410-2zi5iv2t	25	4	in	in	IN
cord-002410-2zi5iv2t	25	5	the	the	DT
cord-002410-2zi5iv2t	25	6	side	side	NN
cord-002410-2zi5iv2t	25	7	chains	chain	NNS
cord-002410-2zi5iv2t	25	8	of	of	IN
cord-002410-2zi5iv2t	25	9	IFNL1	ifnl1	NN
cord-002410-2zi5iv2t	25	10	,	,	,
cord-002410-2zi5iv2t	25	11	IFNL2	IFNL2	NNP
cord-002410-2zi5iv2t	25	12	,	,	,
cord-002410-2zi5iv2t	25	13	and	and	CC
cord-002410-2zi5iv2t	25	14	IFNL3	IFNL3	NNS
cord-002410-2zi5iv2t	25	15	and	and	CC
cord-002410-2zi5iv2t	25	16	amino	amino	NN
cord-002410-2zi5iv2t	25	17	acid	acid	JJ
cord-002410-2zi5iv2t	25	18	differences	difference	NNS
cord-002410-2zi5iv2t	25	19	at	at	IN
cord-002410-2zi5iv2t	25	20	the	the	DT
cord-002410-2zi5iv2t	25	21	receptor	receptor	NN
cord-002410-2zi5iv2t	25	22	binding	bind	VBG
cord-002410-2zi5iv2t	25	23	site	site	NN
cord-002410-2zi5iv2t	25	24	likely	likely	RB
cord-002410-2zi5iv2t	25	25	contribute	contribute	VB
cord-002410-2zi5iv2t	25	26	to	to	IN
cord-002410-2zi5iv2t	25	27	the	the	DT
cord-002410-2zi5iv2t	25	28	differences	difference	NNS
cord-002410-2zi5iv2t	25	29	in	in	IN
cord-002410-2zi5iv2t	25	30	IFNL	IFNL	NNP
cord-002410-2zi5iv2t	25	31	responses	response	NNS
cord-002410-2zi5iv2t	25	32	as	as	IN
cord-002410-2zi5iv2t	25	33	detailed	detail	VBN
cord-002410-2zi5iv2t	25	34	below	below	RB
cord-002410-2zi5iv2t	25	35	.	.	.
cord-002410-2zi5iv2t	26	1	The	the	DT
cord-002410-2zi5iv2t	26	2	expression	expression	NN
cord-002410-2zi5iv2t	26	3	of	of	IN
cord-002410-2zi5iv2t	26	4	IFNL	IFNL	NNP
cord-002410-2zi5iv2t	26	5	genes	gene	NNS
cord-002410-2zi5iv2t	26	6	is	be	VBZ
cord-002410-2zi5iv2t	27	1	tightly	tightly	RB
cord-002410-2zi5iv2t	27	2	controlled	controlled	JJ
cord-002410-2zi5iv2t	27	3	and	and	CC
cord-002410-2zi5iv2t	27	4	expression	expression	NN
cord-002410-2zi5iv2t	27	5	profiles	profile	NNS
cord-002410-2zi5iv2t	27	6	of	of	IN
cord-002410-2zi5iv2t	27	7	IFNL	IFNL	NNP
cord-002410-2zi5iv2t	27	8	subtypes	subtype	NNS
cord-002410-2zi5iv2t	27	9	are	be	VBP
cord-002410-2zi5iv2t	27	10	ligand	ligand	NN
cord-002410-2zi5iv2t	27	11	and	and	CC
cord-002410-2zi5iv2t	27	12	tissue	tissue	NN
cord-002410-2zi5iv2t	27	13	specific	specific	JJ
cord-002410-2zi5iv2t	27	14	[	[	-LRB-
cord-002410-2zi5iv2t	27	15	8	8	CD
cord-002410-2zi5iv2t	27	16	]	]	-RRB-
cord-002410-2zi5iv2t	27	17	.	.	.
cord-002410-2zi5iv2t	28	1	Typically	typically	RB
cord-002410-2zi5iv2t	28	2	,	,	,
cord-002410-2zi5iv2t	28	3	RNA	RNA	NNP
cord-002410-2zi5iv2t	28	4	virus	virus	NN
cord-002410-2zi5iv2t	28	5	infection	infection	NN
cord-002410-2zi5iv2t	28	6	and	and	CC
cord-002410-2zi5iv2t	28	7	the	the	DT
cord-002410-2zi5iv2t	28	8	concomitant	concomitant	JJ
cord-002410-2zi5iv2t	28	9	exposure	exposure	NN
cord-002410-2zi5iv2t	28	10	of	of	IN
cord-002410-2zi5iv2t	28	11	cells	cell	NNS
cord-002410-2zi5iv2t	28	12	to	to	IN
cord-002410-2zi5iv2t	28	13	foreign	foreign	JJ
cord-002410-2zi5iv2t	28	14	RNA	RNA	NNP
cord-002410-2zi5iv2t	28	15	in	in	IN
cord-002410-2zi5iv2t	28	16	cytoplasmic	cytoplasmic	JJ
cord-002410-2zi5iv2t	28	17	or	or	CC
cord-002410-2zi5iv2t	28	18	endosomal	endosomal	JJ
cord-002410-2zi5iv2t	28	19	compartments	compartment	NNS
cord-002410-2zi5iv2t	28	20	lead	lead	VBP
cord-002410-2zi5iv2t	28	21	to	to	IN
cord-002410-2zi5iv2t	28	22	IFNL	IFNL	NNP
cord-002410-2zi5iv2t	28	23	induction	induction	NN
cord-002410-2zi5iv2t	28	24	.	.	.
cord-002410-2zi5iv2t	29	1	In	in	IN
cord-002410-2zi5iv2t	29	2	particular	particular	JJ
cord-002410-2zi5iv2t	29	3	,	,	,
cord-002410-2zi5iv2t	29	4	Sindbis	Sindbis	NNP
cord-002410-2zi5iv2t	29	5	virus	virus	NN
cord-002410-2zi5iv2t	29	6	,	,	,
cord-002410-2zi5iv2t	29	7	dengue	dengue	NN
cord-002410-2zi5iv2t	29	8	virus	virus	NN
cord-002410-2zi5iv2t	29	9	,	,	,
cord-002410-2zi5iv2t	29	10	vesicular	vesicular	JJ
cord-002410-2zi5iv2t	29	11	stomatitis	stomatitis	NN
cord-002410-2zi5iv2t	29	12	virus	virus	NN
cord-002410-2zi5iv2t	29	13	,	,	,
cord-002410-2zi5iv2t	29	14	encephalomyocarditis	encephalomyocarditis	NNP
cord-002410-2zi5iv2t	29	15	virus	virus	NN
cord-002410-2zi5iv2t	29	16	[	[	-LRB-
cord-002410-2zi5iv2t	29	17	1	1	CD
cord-002410-2zi5iv2t	29	18	,	,	,
cord-002410-2zi5iv2t	29	19	2	2	CD
cord-002410-2zi5iv2t	29	20	]	]	-RRB-
cord-002410-2zi5iv2t	29	21	,	,	,
cord-002410-2zi5iv2t	29	22	respiratory	respiratory	JJ
cord-002410-2zi5iv2t	29	23	syncytial	syncytial	JJ
cord-002410-2zi5iv2t	29	24	virus	virus	NN
cord-002410-2zi5iv2t	29	25	[	[	-LRB-
cord-002410-2zi5iv2t	29	26	9	9	CD
cord-002410-2zi5iv2t	29	27	,	,	,
cord-002410-2zi5iv2t	29	28	10	10	CD
cord-002410-2zi5iv2t	29	29	]	]	-RRB-
cord-002410-2zi5iv2t	29	30	,	,	,
cord-002410-2zi5iv2t	29	31	influenza	influenza	NN
cord-002410-2zi5iv2t	29	32	virus	virus	NN
cord-002410-2zi5iv2t	29	33	,	,	,
cord-002410-2zi5iv2t	29	34	Sendai	Sendai	NNP
cord-002410-2zi5iv2t	29	35	virus	virus	NN
cord-002410-2zi5iv2t	29	36	[	[	-LRB-
cord-002410-2zi5iv2t	29	37	11	11	CD
cord-002410-2zi5iv2t	29	38	,	,	,
cord-002410-2zi5iv2t	29	39	12	12	CD
cord-002410-2zi5iv2t	29	40	]	]	-RRB-
cord-002410-2zi5iv2t	29	41	,	,	,
cord-002410-2zi5iv2t	29	42	and	and	CC
cord-002410-2zi5iv2t	29	43	hepatitis	hepatitis	NN
cord-002410-2zi5iv2t	29	44	C	C	NNP
cord-002410-2zi5iv2t	29	45	virus	virus	NN
cord-002410-2zi5iv2t	29	46	(	(	-LRB-
cord-002410-2zi5iv2t	29	47	HCV	HCV	NNP
cord-002410-2zi5iv2t	29	48	)	)	-RRB-
cord-002410-2zi5iv2t	29	49	[	[	-LRB-
cord-002410-2zi5iv2t	29	50	13	13	CD
cord-002410-2zi5iv2t	29	51	]	]	-RRB-
cord-002410-2zi5iv2t	29	52	[	[	-LRB-
cord-002410-2zi5iv2t	29	53	14	14	CD
cord-002410-2zi5iv2t	29	54	]	]	-RRB-
cord-002410-2zi5iv2t	29	55	[	[	-LRB-
cord-002410-2zi5iv2t	29	56	15	15	CD
cord-002410-2zi5iv2t	29	57	]	]	-RRB-
cord-002410-2zi5iv2t	29	58	were	be	VBD
cord-002410-2zi5iv2t	29	59	shown	show	VBN
cord-002410-2zi5iv2t	29	60	to	to	TO
cord-002410-2zi5iv2t	29	61	induce	induce	VB
cord-002410-2zi5iv2t	29	62	IFNLs	IFNLs	NNP
cord-002410-2zi5iv2t	29	63	in	in	IN
cord-002410-2zi5iv2t	29	64	vitro	vitro	FW
cord-002410-2zi5iv2t	29	65	and	and	CC
cord-002410-2zi5iv2t	29	66	in	in	IN
cord-002410-2zi5iv2t	29	67	vivo	vivo	NNP
cord-002410-2zi5iv2t	29	68	.	.	.
cord-002410-2zi5iv2t	30	1	In	in	IN
cord-002410-2zi5iv2t	30	2	addition	addition	NN
cord-002410-2zi5iv2t	30	3	to	to	IN
cord-002410-2zi5iv2t	30	4	RNA	RNA	NNP
cord-002410-2zi5iv2t	30	5	viruses	virus	NNS
cord-002410-2zi5iv2t	30	6	,	,	,
cord-002410-2zi5iv2t	30	7	DNA	dna	NN
cord-002410-2zi5iv2t	30	8	viruses	virus	NNS
cord-002410-2zi5iv2t	30	9	including	include	VBG
cord-002410-2zi5iv2t	30	10	cytomegalovirus	cytomegalovirus	NNP
cord-002410-2zi5iv2t	30	11	and	and	CC
cord-002410-2zi5iv2t	30	12	herpes	herpes	NN
cord-002410-2zi5iv2t	30	13	simplex	simplex	NNP
cord-002410-2zi5iv2t	30	14	virus	virus	NN
cord-002410-2zi5iv2t	30	15	can	can	MD
cord-002410-2zi5iv2t	30	16	induce	induce	VB
cord-002410-2zi5iv2t	30	17	IFNLs	IFNLs	NNP
cord-002410-2zi5iv2t	30	18	[	[	-LRB-
cord-002410-2zi5iv2t	30	19	16	16	CD
cord-002410-2zi5iv2t	30	20	,	,	,
cord-002410-2zi5iv2t	30	21	17	17	CD
cord-002410-2zi5iv2t	30	22	]	]	-RRB-
cord-002410-2zi5iv2t	30	23	.	.	.
cord-002410-2zi5iv2t	31	1	While	while	IN
cord-002410-2zi5iv2t	31	2	almost	almost	RB
cord-002410-2zi5iv2t	31	3	any	any	DT
cord-002410-2zi5iv2t	31	4	cell	cell	NN
cord-002410-2zi5iv2t	31	5	type	type	NN
cord-002410-2zi5iv2t	31	6	can	can	MD
cord-002410-2zi5iv2t	31	7	express	express	VB
cord-002410-2zi5iv2t	31	8	IFNLs	IFNLs	NNP
cord-002410-2zi5iv2t	31	9	,	,	,
cord-002410-2zi5iv2t	31	10	the	the	DT
cord-002410-2zi5iv2t	31	11	most	most	RBS
cord-002410-2zi5iv2t	31	12	prominent	prominent	JJ
cord-002410-2zi5iv2t	31	13	producers	producer	NNS
cord-002410-2zi5iv2t	32	1	B	b	NN
cord-002410-2zi5iv2t	32	2	  	  	_SP
cord-002410-2zi5iv2t	33	1	IFNL4_HUMAN	IFNL4_HUMAN	NNP
cord-002410-2zi5iv2t	33	2	 	 	_SP
cord-002410-2zi5iv2t	34	1	IFNL1_HUMAN	IFNL1_HUMAN	NNP
cord-002410-2zi5iv2t	34	2	 	 	_SP
cord-002410-2zi5iv2t	35	1	IFNL2_HUMAN	IFNL2_HUMAN	NNP
cord-002410-2zi5iv2t	35	2	 	 	_SP
cord-002410-2zi5iv2t	36	1	IFNL3_HUMAN	IFNL3_HUMAN	NNP
cord-002410-2zi5iv2t	36	2	  	  	_SP
cord-002410-2zi5iv2t	37	1	IFNL4_HUMAN	IFNL4_HUMAN	NNP
cord-002410-2zi5iv2t	37	2	 	 	_SP
cord-002410-2zi5iv2t	38	1	IFNL1_HUMAN	IFNL1_HUMAN	NNP
cord-002410-2zi5iv2t	38	2	 	 	_SP
cord-002410-2zi5iv2t	39	1	IFNL2_HUMAN	IFNL2_HUMAN	NNP
cord-002410-2zi5iv2t	39	2	 	 	_SP
cord-002410-2zi5iv2t	40	1	IFNL3_HUMAN	IFNL3_HUMAN	NNP
cord-002410-2zi5iv2t	40	2	  	  	_SP
cord-002410-2zi5iv2t	41	1	IFNL4_HUMAN	IFNL4_HUMAN	NNP
cord-002410-2zi5iv2t	41	2	 	 	_SP
cord-002410-2zi5iv2t	42	1	IFNL1_HUMAN	IFNL1_HUMAN	NNP
cord-002410-2zi5iv2t	42	2	 	 	_SP
cord-002410-2zi5iv2t	43	1	IFNL2_HUMAN	IFNL2_HUMAN	NNP
cord-002410-2zi5iv2t	43	2	 	 	_SP
cord-002410-2zi5iv2t	44	1	IFNL3_HUMAN	IFNL3_HUMAN	NNP
cord-002410-2zi5iv2t	44	2	  	  	_SP
cord-002410-2zi5iv2t	45	1	IFNL4_HUMAN	IFNL4_HUMAN	NNP
cord-002410-2zi5iv2t	45	2	 	 	_SP
cord-002410-2zi5iv2t	46	1	IFNL1_HUMAN	IFNL1_HUMAN	NNP
cord-002410-2zi5iv2t	46	2	 	 	_SP
cord-002410-2zi5iv2t	47	1	IFNL2_HUMAN	IFNL2_HUMAN	NNP
cord-002410-2zi5iv2t	47	2	 	 	_SP
cord-002410-2zi5iv2t	48	1	IFNL3_HUMAN	IFNL3_HUMAN	NNP
cord-002410-2zi5iv2t	49	1	----MAAAWTVVLVTLVLGLAVAGPVPTSK---	----MAAAWTVVLVTLVLGLAVAGPVPTSK---	.
cord-002410-2zi5iv2t	50	1	PTTTGKGCHIGRFKSLSPQELASFKKA	PTTTGKGCHIGRFKSLSPQELASFKKA	NNP
cord-002410-2zi5iv2t	50	2	  	  	_SP
cord-002410-2zi5iv2t	51	1	------------------------------------------------------------MKLDMTGDCTPVLVLMAAVLTVTGAVPVARLHGALPDARGCHIAQFKSLSPQELQAFKRA	------------------------------------------------------------MKLDMTGDCTPVLVLMAAVLTVTGAVPVARLHGALPDARGCHIAQFKSLSPQELQAFKRA	NNPS
cord-002410-2zi5iv2t	51	2	 	 	_SP
cord-002410-2zi5iv2t	52	1	----MTGDCMPVLVLMAAVLTVTGAVPVARLRGALPDARGCHIAQFKSLSPQELQAFKRA	----MTGDCMPVLVLMAAVLTVTGAVPVARLRGALPDARGCHIAQFKSLSPQELQAFKRA	NFP
cord-002410-2zi5iv2t	52	2	  	  	_SP
cord-002410-2zi5iv2t	53	1	RDALEESLKLKNWSCSSPVFP	RDALEESLKLKNWSCSSPVFP	NNP
cord-002410-2zi5iv2t	53	2	-	-	HYPH
cord-002410-2zi5iv2t	53	3	GNWDLRLLQVRERPVALEAELALTLKVLEAA	GNWDLRLLQVRERPVALEAELALTLKVLEAA	NNP
cord-002410-2zi5iv2t	53	4	--	--	:
cord-002410-2zi5iv2t	53	5	AGPAL	agpal	NN
cord-002410-2zi5iv2t	53	6	 	 	_SP
cord-002410-2zi5iv2t	53	7	KDALEESLLLKDCRCHSRLFP	KDALEESLLLKDCRCHSRLFP	NNP
cord-002410-2zi5iv2t	53	8	-	-	HYPH
cord-002410-2zi5iv2t	53	9	RTWDLRQLQVRERPMALEAELALTLKVLEATADTDPAL	RTWDLRQLQVRERPMALEAELALTLKVLEATADTDPAL	NNP
cord-002410-2zi5iv2t	53	10	 	 	_SP
cord-002410-2zi5iv2t	54	1	KDALEESLLLKDCKCRSRLFP	KDALEESLLLKDCKCRSRLFP	NNP
cord-002410-2zi5iv2t	54	2	-	-	HYPH
cord-002410-2zi5iv2t	54	3	RTWDLRQLQVRERPVALEAELALTLKVLEATADTDPAL	RTWDLRQLQVRERPVALEAELALTLKVLEATADTDPAL	NNP
cord-002410-2zi5iv2t	54	4	 	 	_SP
cord-002410-2zi5iv2t	55	1	:	:	:
cord-002410-2zi5iv2t	55	2	 	 	_SP
cord-002410-2zi5iv2t	55	3	:	:	:
cord-002410-2zi5iv2t	55	4	 	 	_SP
cord-002410-2zi5iv2t	55	5	:	:	:
cord-002410-2zi5iv2t	55	6	 	 	_SP
cord-002410-2zi5iv2t	55	7	:	:	:
cord-002410-2zi5iv2t	55	8	 	 	_SP
cord-002410-2zi5iv2t	55	9	:	:	:
cord-002410-2zi5iv2t	55	10	 	 	_SP
cord-002410-2zi5iv2t	55	11	:	:	:
cord-002410-2zi5iv2t	55	12	.	.	.
cord-002410-2zi5iv2t	55	13	.	.	.
cord-002410-2zi5iv2t	56	1	[	[	-LRB-
cord-002410-2zi5iv2t	56	2	37	37	CD
cord-002410-2zi5iv2t	56	3	]	]	-RRB-
cord-002410-2zi5iv2t	56	4	of	of	IN
cord-002410-2zi5iv2t	56	5	IFNL	IFNL	NNP
cord-002410-2zi5iv2t	56	6	proteins	protein	NNS
cord-002410-2zi5iv2t	56	7	(	(	-LRB-
cord-002410-2zi5iv2t	56	8	IDs	id	NNS
cord-002410-2zi5iv2t	56	9	:	:	:
cord-002410-2zi5iv2t	56	10	Q8IU54	Q8IU54	NNP
cord-002410-2zi5iv2t	56	11	,	,	,
cord-002410-2zi5iv2t	56	12	Q8IZJ0	Q8IZJ0	NNS
cord-002410-2zi5iv2t	56	13	,	,	,
cord-002410-2zi5iv2t	56	14	Q8IZI9	Q8IZI9	NNP
cord-002410-2zi5iv2t	56	15	,	,	,
cord-002410-2zi5iv2t	56	16	and	and	CC
cord-002410-2zi5iv2t	56	17	K9M1U5	K9M1U5	NNP
cord-002410-2zi5iv2t	56	18	)	)	-RRB-
cord-002410-2zi5iv2t	56	19	.	.	.
cord-002410-2zi5iv2t	57	1	Exons	exon	NNS
cord-002410-2zi5iv2t	57	2	are	be	VBP
cord-002410-2zi5iv2t	57	3	indicated	indicate	VBN
cord-002410-2zi5iv2t	57	4	by	by	IN
cord-002410-2zi5iv2t	57	5	the	the	DT
cord-002410-2zi5iv2t	57	6	black	black	JJ
cord-002410-2zi5iv2t	57	7	and	and	CC
cord-002410-2zi5iv2t	57	8	white	white	JJ
cord-002410-2zi5iv2t	57	9	boxes	box	NNS
cord-002410-2zi5iv2t	57	10	below	below	IN
cord-002410-2zi5iv2t	57	11	the	the	DT
cord-002410-2zi5iv2t	57	12	sequences	sequence	NNS
cord-002410-2zi5iv2t	57	13	.	.	.
cord-002410-2zi5iv2t	58	1	Positions	position	NNS
cord-002410-2zi5iv2t	58	2	of	of	IN
cord-002410-2zi5iv2t	58	3	helices	helix	NNS
cord-002410-2zi5iv2t	58	4	are	be	VBP
cord-002410-2zi5iv2t	58	5	indicated	indicate	VBN
cord-002410-2zi5iv2t	58	6	by	by	IN
cord-002410-2zi5iv2t	58	7	the	the	DT
cord-002410-2zi5iv2t	58	8	lines	line	NNS
cord-002410-2zi5iv2t	58	9	above	above	IN
cord-002410-2zi5iv2t	58	10	the	the	DT
cord-002410-2zi5iv2t	58	11	sequences	sequence	NNS
cord-002410-2zi5iv2t	58	12	.	.	.
cord-002410-2zi5iv2t	59	1	Identical	identical	JJ
cord-002410-2zi5iv2t	59	2	amino	amino	JJ
cord-002410-2zi5iv2t	59	3	acids	acid	NNS
cord-002410-2zi5iv2t	59	4	are	be	VBP
cord-002410-2zi5iv2t	59	5	marked	mark	VBN
cord-002410-2zi5iv2t	59	6	by	by	IN
cord-002410-2zi5iv2t	59	7	an	an	DT
cord-002410-2zi5iv2t	59	8	asterisk	asterisk	NN
cord-002410-2zi5iv2t	59	9	(	(	-LRB-
cord-002410-2zi5iv2t	59	10	*	*	NFP
cord-002410-2zi5iv2t	59	11	)	)	-RRB-
cord-002410-2zi5iv2t	59	12	;	;	,
cord-002410-2zi5iv2t	59	13	conserved	conserved	JJ
cord-002410-2zi5iv2t	59	14	amino	amino	NN
cord-002410-2zi5iv2t	59	15	acids	acid	NNS
cord-002410-2zi5iv2t	59	16	by	by	IN
cord-002410-2zi5iv2t	59	17	a	a	DT
cord-002410-2zi5iv2t	59	18	colon	colon	NN
cord-002410-2zi5iv2t	59	19	(	(	-LRB-
cord-002410-2zi5iv2t	59	20	:)	:)	UH
cord-002410-2zi5iv2t	59	21	;	;	:
cord-002410-2zi5iv2t	59	22	and	and	CC
cord-002410-2zi5iv2t	59	23	semiconserved	semiconserve	VBN
cord-002410-2zi5iv2t	59	24	amino	amino	NN
cord-002410-2zi5iv2t	59	25	acids	acid	NNS
cord-002410-2zi5iv2t	59	26	by	by	IN
cord-002410-2zi5iv2t	59	27	a	a	DT
cord-002410-2zi5iv2t	59	28	period	period	NN
cord-002410-2zi5iv2t	59	29	(	(	-LRB-
cord-002410-2zi5iv2t	59	30	.	.	.
cord-002410-2zi5iv2t	59	31	)	)	-RRB-
cord-002410-2zi5iv2t	59	32	.	.	.
cord-002410-2zi5iv2t	60	1	of	of	IN
cord-002410-2zi5iv2t	60	2	these	these	DT
cord-002410-2zi5iv2t	60	3	antiviral	antiviral	JJ
cord-002410-2zi5iv2t	60	4	cytokines	cytokine	NNS
cord-002410-2zi5iv2t	60	5	are	be	VBP
cord-002410-2zi5iv2t	60	6	myeloid	myeloid	JJ
cord-002410-2zi5iv2t	60	7	and	and	CC
cord-002410-2zi5iv2t	60	8	plasmacytoid	plasmacytoid	JJ
cord-002410-2zi5iv2t	60	9	dendritic	dendritic	JJ
cord-002410-2zi5iv2t	60	10	cells	cell	NNS
cord-002410-2zi5iv2t	60	11	[	[	-LRB-
cord-002410-2zi5iv2t	60	12	8	8	CD
cord-002410-2zi5iv2t	60	13	,	,	,
cord-002410-2zi5iv2t	60	14	[	[	-LRB-
cord-002410-2zi5iv2t	60	15	18	18	CD
cord-002410-2zi5iv2t	60	16	]	]	-RRB-
cord-002410-2zi5iv2t	61	1	[	[	-LRB-
cord-002410-2zi5iv2t	61	2	19	19	CD
cord-002410-2zi5iv2t	61	3	]	]	-RRB-
cord-002410-2zi5iv2t	61	4	[	[	-LRB-
cord-002410-2zi5iv2t	61	5	20	20	CD
cord-002410-2zi5iv2t	61	6	]	]	-RRB-
cord-002410-2zi5iv2t	61	7	[	[	-LRB-
cord-002410-2zi5iv2t	61	8	21	21	CD
cord-002410-2zi5iv2t	61	9	]	]	-RRB-
cord-002410-2zi5iv2t	61	10	.	.	.
cord-002410-2zi5iv2t	62	1	Tissues	tissue	NNS
cord-002410-2zi5iv2t	62	2	with	with	IN
cord-002410-2zi5iv2t	62	3	strong	strong	JJ
cord-002410-2zi5iv2t	62	4	IFNL	IFNL	NNP
cord-002410-2zi5iv2t	62	5	induction	induction	NN
cord-002410-2zi5iv2t	62	6	upon	upon	IN
cord-002410-2zi5iv2t	62	7	virus	virus	NN
cord-002410-2zi5iv2t	62	8	infection	infection	NN
cord-002410-2zi5iv2t	62	9	are	be	VBP
cord-002410-2zi5iv2t	62	10	the	the	DT
cord-002410-2zi5iv2t	62	11	lung	lung	NN
cord-002410-2zi5iv2t	62	12	and	and	CC
cord-002410-2zi5iv2t	62	13	the	the	DT
cord-002410-2zi5iv2t	62	14	liver	liver	NN
cord-002410-2zi5iv2t	62	15	with	with	IN
cord-002410-2zi5iv2t	62	16	a	a	DT
cord-002410-2zi5iv2t	62	17	strong	strong	JJ
cord-002410-2zi5iv2t	62	18	contribution	contribution	NN
cord-002410-2zi5iv2t	62	19	of	of	IN
cord-002410-2zi5iv2t	62	20	airway	airway	NN
cord-002410-2zi5iv2t	62	21	epithelial	epithelial	JJ
cord-002410-2zi5iv2t	62	22	cells	cell	NNS
cord-002410-2zi5iv2t	62	23	and	and	CC
cord-002410-2zi5iv2t	62	24	hepatocytes	hepatocyte	NNS
cord-002410-2zi5iv2t	62	25	[	[	-LRB-
cord-002410-2zi5iv2t	62	26	15	15	CD
cord-002410-2zi5iv2t	62	27	,	,	,
cord-002410-2zi5iv2t	62	28	[	[	-LRB-
cord-002410-2zi5iv2t	62	29	22	22	CD
cord-002410-2zi5iv2t	62	30	]	]	-RRB-
cord-002410-2zi5iv2t	62	31	[	[	-LRB-
cord-002410-2zi5iv2t	62	32	23	23	CD
cord-002410-2zi5iv2t	62	33	]	]	-RRB-
cord-002410-2zi5iv2t	63	1	[	[	-LRB-
cord-002410-2zi5iv2t	63	2	24	24	CD
cord-002410-2zi5iv2t	63	3	]	]	-RRB-
cord-002410-2zi5iv2t	63	4	[	[	-LRB-
cord-002410-2zi5iv2t	63	5	25	25	CD
cord-002410-2zi5iv2t	63	6	]	]	-RRB-
cord-002410-2zi5iv2t	63	7	[	[	-LRB-
cord-002410-2zi5iv2t	63	8	26	26	CD
cord-002410-2zi5iv2t	63	9	]	]	-RRB-
cord-002410-2zi5iv2t	63	10	[	[	-LRB-
cord-002410-2zi5iv2t	63	11	27	27	CD
cord-002410-2zi5iv2t	63	12	]	]	-RRB-
cord-002410-2zi5iv2t	63	13	[	[	-LRB-
cord-002410-2zi5iv2t	63	14	28	28	CD
cord-002410-2zi5iv2t	63	15	]	]	-RRB-
cord-002410-2zi5iv2t	63	16	[	[	-LRB-
cord-002410-2zi5iv2t	63	17	29	29	CD
cord-002410-2zi5iv2t	63	18	]	]	-RRB-
cord-002410-2zi5iv2t	63	19	.	.	.
cord-002410-2zi5iv2t	64	1	Limited	limited	JJ
cord-002410-2zi5iv2t	64	2	data	datum	NNS
cord-002410-2zi5iv2t	64	3	is	be	VBZ
cord-002410-2zi5iv2t	64	4	available	available	JJ
cord-002410-2zi5iv2t	64	5	on	on	IN
cord-002410-2zi5iv2t	64	6	the	the	DT
cord-002410-2zi5iv2t	64	7	expression	expression	NN
cord-002410-2zi5iv2t	64	8	kinetics	kinetics	NN
cord-002410-2zi5iv2t	64	9	of	of	IN
cord-002410-2zi5iv2t	64	10	IFNLs	IFNLs	NNP
cord-002410-2zi5iv2t	64	11	in	in	IN
cord-002410-2zi5iv2t	64	12	different	different	JJ
cord-002410-2zi5iv2t	64	13	cell	cell	NN
cord-002410-2zi5iv2t	64	14	types	type	NNS
cord-002410-2zi5iv2t	64	15	.	.	.
cord-002410-2zi5iv2t	65	1	It	-PRON-	PRP
cord-002410-2zi5iv2t	65	2	seems	seem	VBZ
cord-002410-2zi5iv2t	65	3	,	,	,
cord-002410-2zi5iv2t	65	4	however	however	RB
cord-002410-2zi5iv2t	65	5	,	,	,
cord-002410-2zi5iv2t	65	6	that	that	IN
cord-002410-2zi5iv2t	65	7	IFNL	IFNL	NNP
cord-002410-2zi5iv2t	65	8	expression	expression	NN
cord-002410-2zi5iv2t	65	9	onset	onset	NN
cord-002410-2zi5iv2t	65	10	and	and	CC
cord-002410-2zi5iv2t	65	11	duration	duration	NN
cord-002410-2zi5iv2t	65	12	differ	differ	VBP
cord-002410-2zi5iv2t	65	13	for	for	IN
cord-002410-2zi5iv2t	65	14	the	the	DT
cord-002410-2zi5iv2t	65	15	four	four	CD
cord-002410-2zi5iv2t	65	16	subtypes	subtype	NNS
cord-002410-2zi5iv2t	65	17	.	.	.
cord-002410-2zi5iv2t	66	1	For	for	IN
cord-002410-2zi5iv2t	66	2	instance	instance	NN
cord-002410-2zi5iv2t	66	3	,	,	,
cord-002410-2zi5iv2t	66	4	primary	primary	JJ
cord-002410-2zi5iv2t	66	5	human	human	JJ
cord-002410-2zi5iv2t	66	6	hepatocytes	hepatocyte	NNS
cord-002410-2zi5iv2t	66	7	(	(	-LRB-
cord-002410-2zi5iv2t	66	8	PHH	PHH	NNP
cord-002410-2zi5iv2t	66	9	)	)	-RRB-
cord-002410-2zi5iv2t	66	10	carrying	carry	VBG
cord-002410-2zi5iv2t	66	11	the	the	DT
cord-002410-2zi5iv2t	66	12	single	single	JJ
cord-002410-2zi5iv2t	66	13	nucleotide	nucleotide	JJ
cord-002410-2zi5iv2t	66	14	polymorphism	polymorphism	NN
cord-002410-2zi5iv2t	66	15	(	(	-LRB-
cord-002410-2zi5iv2t	66	16	SNP	SNP	NNP
cord-002410-2zi5iv2t	66	17	)	)	-RRB-
cord-002410-2zi5iv2t	66	18	responsible	responsible	JJ
cord-002410-2zi5iv2t	66	19	for	for	IN
cord-002410-2zi5iv2t	66	20	IFNL4	IFNL4	NNP
cord-002410-2zi5iv2t	66	21	expression	expression	NN
cord-002410-2zi5iv2t	66	22	show	show	VB
cord-002410-2zi5iv2t	66	23	an	an	DT
cord-002410-2zi5iv2t	66	24	early	early	JJ
cord-002410-2zi5iv2t	66	25	and	and	CC
cord-002410-2zi5iv2t	66	26	short	short	JJ
cord-002410-2zi5iv2t	66	27	IFNL4	ifnl4	NN
cord-002410-2zi5iv2t	66	28	expression	expression	NN
cord-002410-2zi5iv2t	66	29	(	(	-LRB-
cord-002410-2zi5iv2t	66	30	2	2	CD
cord-002410-2zi5iv2t	66	31	to	to	IN
cord-002410-2zi5iv2t	66	32	6	6	CD
cord-002410-2zi5iv2t	66	33	h	h	NN
cord-002410-2zi5iv2t	66	34	after	after	IN
cord-002410-2zi5iv2t	66	35	stimulation	stimulation	NN
cord-002410-2zi5iv2t	66	36	)	)	-RRB-
cord-002410-2zi5iv2t	66	37	,	,	,
cord-002410-2zi5iv2t	66	38	while	while	IN
cord-002410-2zi5iv2t	66	39	IFNL3	IFNL3	NNP
cord-002410-2zi5iv2t	66	40	was	be	VBD
cord-002410-2zi5iv2t	66	41	detectable	detectable	JJ
cord-002410-2zi5iv2t	66	42	from	from	IN
cord-002410-2zi5iv2t	66	43	2	2	CD
cord-002410-2zi5iv2t	66	44	to	to	IN
cord-002410-2zi5iv2t	66	45	24	24	CD
cord-002410-2zi5iv2t	66	46	h	h	NN
cord-002410-2zi5iv2t	66	47	after	after	IN
cord-002410-2zi5iv2t	66	48	stimulation	stimulation	NN
cord-002410-2zi5iv2t	66	49	with	with	IN
cord-002410-2zi5iv2t	66	50	a	a	DT
cord-002410-2zi5iv2t	66	51	synthetic	synthetic	JJ
cord-002410-2zi5iv2t	66	52	poly	poly	NN
cord-002410-2zi5iv2t	66	53	I	i	NN
cord-002410-2zi5iv2t	66	54	:	:	:
cord-002410-2zi5iv2t	66	55	C	C	NNP
cord-002410-2zi5iv2t	66	56	RNA	RNA	NNP
cord-002410-2zi5iv2t	66	57	ligand	ligand	NN
cord-002410-2zi5iv2t	66	58	[	[	-LRB-
cord-002410-2zi5iv2t	66	59	4	4	CD
cord-002410-2zi5iv2t	66	60	]	]	-RRB-
cord-002410-2zi5iv2t	66	61	.	.	.
cord-002410-2zi5iv2t	67	1	Differences	difference	NNS
cord-002410-2zi5iv2t	67	2	in	in	IN
cord-002410-2zi5iv2t	67	3	positive	positive	JJ
cord-002410-2zi5iv2t	67	4	or	or	CC
cord-002410-2zi5iv2t	67	5	negative	negative	JJ
cord-002410-2zi5iv2t	67	6	feedback	feedback	NN
cord-002410-2zi5iv2t	67	7	mechanisms	mechanism	NNS
cord-002410-2zi5iv2t	67	8	may	may	MD
cord-002410-2zi5iv2t	67	9	explain	explain	VB
cord-002410-2zi5iv2t	67	10	the	the	DT
cord-002410-2zi5iv2t	67	11	varying	vary	VBG
cord-002410-2zi5iv2t	67	12	expression	expression	NN
cord-002410-2zi5iv2t	67	13	kinetics	kinetic	NNS
cord-002410-2zi5iv2t	67	14	for	for	IN
cord-002410-2zi5iv2t	67	15	IFNL	IFNL	NNP
cord-002410-2zi5iv2t	67	16	subtypes	subtype	NNS
cord-002410-2zi5iv2t	67	17	.	.	.
cord-002410-2zi5iv2t	68	1	IFNL1	IFNL1	NNS
cord-002410-2zi5iv2t	68	2	through	through	IN
cord-002410-2zi5iv2t	68	3	IFNL3	IFNL3	NNS
cord-002410-2zi5iv2t	68	4	are	be	VBP
cord-002410-2zi5iv2t	68	5	typically	typically	RB
cord-002410-2zi5iv2t	68	6	induced	induce	VBN
cord-002410-2zi5iv2t	68	7	simultaneously	simultaneously	RB
cord-002410-2zi5iv2t	68	8	and	and	CC
cord-002410-2zi5iv2t	68	9	this	this	DT
cord-002410-2zi5iv2t	68	10	is	be	VBZ
cord-002410-2zi5iv2t	68	11	reflected	reflect	VBN
cord-002410-2zi5iv2t	68	12	by	by	IN
cord-002410-2zi5iv2t	68	13	common	common	JJ
cord-002410-2zi5iv2t	68	14	transcription	transcription	NN
cord-002410-2zi5iv2t	68	15	factors	factor	NNS
cord-002410-2zi5iv2t	68	16	and	and	CC
cord-002410-2zi5iv2t	68	17	binding	bind	VBG
cord-002410-2zi5iv2t	68	18	sites	site	NNS
cord-002410-2zi5iv2t	68	19	in	in	IN
cord-002410-2zi5iv2t	68	20	the	the	DT
cord-002410-2zi5iv2t	68	21	promoter	promoter	NN
cord-002410-2zi5iv2t	68	22	regions	region	NNS
cord-002410-2zi5iv2t	68	23	.	.	.
cord-002410-2zi5iv2t	69	1	Activator	activator	NN
cord-002410-2zi5iv2t	69	2	protein	protein	NN
cord-002410-2zi5iv2t	69	3	1	1	CD
cord-002410-2zi5iv2t	69	4	,	,	,
cord-002410-2zi5iv2t	69	5	IFN	IFN	NNP
cord-002410-2zi5iv2t	69	6	response	response	NN
cord-002410-2zi5iv2t	69	7	factor	factor	NN
cord-002410-2zi5iv2t	69	8	3	3	CD
cord-002410-2zi5iv2t	69	9	(	(	-LRB-
cord-002410-2zi5iv2t	69	10	IRF3	IRF3	NNP
cord-002410-2zi5iv2t	69	11	)	)	-RRB-
cord-002410-2zi5iv2t	69	12	,	,	,
cord-002410-2zi5iv2t	69	13	IRF7	IRF7	NNP
cord-002410-2zi5iv2t	69	14	,	,	,
cord-002410-2zi5iv2t	69	15	and	and	CC
cord-002410-2zi5iv2t	69	16	nuclear	nuclear	JJ
cord-002410-2zi5iv2t	69	17	factor	factor	NN
cord-002410-2zi5iv2t	69	18	kappa	kappa	NN
cord-002410-2zi5iv2t	69	19	beta	beta	NN
cord-002410-2zi5iv2t	69	20	(	(	-LRB-
cord-002410-2zi5iv2t	69	21	NF	NF	NNP
cord-002410-2zi5iv2t	69	22	-	-	HYPH
cord-002410-2zi5iv2t	69	23	kB	kB	NNP
cord-002410-2zi5iv2t	69	24	)	)	-RRB-
cord-002410-2zi5iv2t	69	25	are	be	VBP
cord-002410-2zi5iv2t	69	26	thought	think	VBN
cord-002410-2zi5iv2t	69	27	to	to	TO
cord-002410-2zi5iv2t	69	28	bind	bind	VB
cord-002410-2zi5iv2t	69	29	to	to	IN
cord-002410-2zi5iv2t	69	30	the	the	DT
cord-002410-2zi5iv2t	69	31	promoter	promoter	NN
cord-002410-2zi5iv2t	69	32	of	of	IN
cord-002410-2zi5iv2t	69	33	all	all	DT
cord-002410-2zi5iv2t	69	34	INFL	INFL	NNP
cord-002410-2zi5iv2t	69	35	genes	gene	NNS
cord-002410-2zi5iv2t	69	36	[	[	-LRB-
cord-002410-2zi5iv2t	69	37	11	11	CD
cord-002410-2zi5iv2t	69	38	,	,	,
cord-002410-2zi5iv2t	69	39	12	12	CD
cord-002410-2zi5iv2t	69	40	,	,	,
cord-002410-2zi5iv2t	69	41	[	[	-LRB-
cord-002410-2zi5iv2t	69	42	30	30	CD
cord-002410-2zi5iv2t	69	43	]	]	-RRB-
cord-002410-2zi5iv2t	69	44	[	[	-LRB-
cord-002410-2zi5iv2t	69	45	31	31	CD
cord-002410-2zi5iv2t	69	46	]	]	-RRB-
cord-002410-2zi5iv2t	69	47	[	[	-LRB-
cord-002410-2zi5iv2t	69	48	32	32	CD
cord-002410-2zi5iv2t	69	49	]	]	-RRB-
cord-002410-2zi5iv2t	69	50	[	[	-LRB-
cord-002410-2zi5iv2t	69	51	33	33	CD
cord-002410-2zi5iv2t	69	52	]	]	-RRB-
cord-002410-2zi5iv2t	69	53	[	[	-LRB-
cord-002410-2zi5iv2t	69	54	34	34	CD
cord-002410-2zi5iv2t	69	55	]	]	-RRB-
cord-002410-2zi5iv2t	69	56	[	[	-LRB-
cord-002410-2zi5iv2t	69	57	35	35	CD
cord-002410-2zi5iv2t	69	58	]	]	-RRB-
cord-002410-2zi5iv2t	69	59	[	[	-LRB-
cord-002410-2zi5iv2t	69	60	36	36	CD
cord-002410-2zi5iv2t	69	61	]	]	-RRB-
cord-002410-2zi5iv2t	69	62	.	.	.
cord-002410-2zi5iv2t	70	1	Additionally	additionally	RB
cord-002410-2zi5iv2t	70	2	,	,	,
cord-002410-2zi5iv2t	70	3	Med23	Med23	NNP
cord-002410-2zi5iv2t	70	4	seems	seem	VBZ
cord-002410-2zi5iv2t	70	5	to	to	TO
cord-002410-2zi5iv2t	70	6	be	be	VB
cord-002410-2zi5iv2t	70	7	a	a	DT
cord-002410-2zi5iv2t	70	8	transcriptional	transcriptional	JJ
cord-002410-2zi5iv2t	70	9	coactivator	coactivator	NN
cord-002410-2zi5iv2t	70	10	[	[	-LRB-
cord-002410-2zi5iv2t	70	11	17	17	CD
cord-002410-2zi5iv2t	70	12	]	]	-RRB-
cord-002410-2zi5iv2t	70	13	.	.	.
cord-002410-2zi5iv2t	71	1	Taken	take	VBN
cord-002410-2zi5iv2t	71	2	together	together	RB
cord-002410-2zi5iv2t	71	3	,	,	,
cord-002410-2zi5iv2t	71	4	IFNLs	ifnl	NNS
cord-002410-2zi5iv2t	71	5	are	be	VBP
cord-002410-2zi5iv2t	71	6	induced	induce	VBN
cord-002410-2zi5iv2t	71	7	upon	upon	IN
cord-002410-2zi5iv2t	71	8	sensing	sensing	NN
cord-002410-2zi5iv2t	71	9	of	of	IN
cord-002410-2zi5iv2t	71	10	virus	virus	NN
cord-002410-2zi5iv2t	71	11	infection	infection	NN
cord-002410-2zi5iv2t	71	12	in	in	IN
cord-002410-2zi5iv2t	71	13	particular	particular	JJ
cord-002410-2zi5iv2t	71	14	after	after	IN
cord-002410-2zi5iv2t	71	15	lung	lung	NN
cord-002410-2zi5iv2t	71	16	and	and	CC
cord-002410-2zi5iv2t	71	17	liver	liver	NN
cord-002410-2zi5iv2t	71	18	infection	infection	NN
cord-002410-2zi5iv2t	71	19	.	.	.
cord-002410-2zi5iv2t	72	1	The	the	DT
cord-002410-2zi5iv2t	72	2	receptor	receptor	NN
cord-002410-2zi5iv2t	72	3	for	for	IN
cord-002410-2zi5iv2t	72	4	all	all	DT
cord-002410-2zi5iv2t	72	5	four	four	CD
cord-002410-2zi5iv2t	72	6	IFNLs	IFNLs	NNP
cord-002410-2zi5iv2t	72	7	is	be	VBZ
cord-002410-2zi5iv2t	72	8	composed	compose	VBN
cord-002410-2zi5iv2t	72	9	of	of	IN
cord-002410-2zi5iv2t	72	10	two	two	CD
cord-002410-2zi5iv2t	72	11	subunits	subunit	NNS
cord-002410-2zi5iv2t	72	12	,	,	,
cord-002410-2zi5iv2t	72	13	the	the	DT
cord-002410-2zi5iv2t	72	14	alpha	alpha	NN
cord-002410-2zi5iv2t	72	15	-	-	HYPH
cord-002410-2zi5iv2t	72	16	subunit	subunit	NN
cord-002410-2zi5iv2t	72	17	IFNLR1	ifnlr1	RB
cord-002410-2zi5iv2t	72	18	encoded	encode	VBN
cord-002410-2zi5iv2t	72	19	on	on	IN
cord-002410-2zi5iv2t	72	20	chromosome	chromosome	NN
cord-002410-2zi5iv2t	72	21	1	1	CD
cord-002410-2zi5iv2t	72	22	and	and	CC
cord-002410-2zi5iv2t	72	23	the	the	DT
cord-002410-2zi5iv2t	72	24	beta	beta	NN
cord-002410-2zi5iv2t	72	25	-	-	HYPH
cord-002410-2zi5iv2t	72	26	subunit	subunit	NN
cord-002410-2zi5iv2t	72	27	IL10RB	IL10RB	NNP
cord-002410-2zi5iv2t	72	28	encoded	encode	VBN
cord-002410-2zi5iv2t	72	29	on	on	IN
cord-002410-2zi5iv2t	72	30	chromosome	chromosome	NN
cord-002410-2zi5iv2t	72	31	21	21	CD
cord-002410-2zi5iv2t	72	32	[	[	-LRB-
cord-002410-2zi5iv2t	72	33	40	40	CD
cord-002410-2zi5iv2t	72	34	]	]	-RRB-
cord-002410-2zi5iv2t	73	1	[	[	-LRB-
cord-002410-2zi5iv2t	73	2	41	41	CD
cord-002410-2zi5iv2t	73	3	]	]	-RRB-
cord-002410-2zi5iv2t	74	1	[	[	-LRB-
cord-002410-2zi5iv2t	74	2	42	42	CD
cord-002410-2zi5iv2t	74	3	]	]	-RRB-
cord-002410-2zi5iv2t	74	4	[	[	-LRB-
cord-002410-2zi5iv2t	74	5	43	43	CD
cord-002410-2zi5iv2t	74	6	]	]	-RRB-
cord-002410-2zi5iv2t	74	7	[	[	-LRB-
cord-002410-2zi5iv2t	74	8	44	44	CD
cord-002410-2zi5iv2t	74	9	]	]	-RRB-
cord-002410-2zi5iv2t	74	10	.	.	.
cord-002410-2zi5iv2t	75	1	The	the	DT
cord-002410-2zi5iv2t	75	2	former	former	JJ
cord-002410-2zi5iv2t	75	3	is	be	VBZ
cord-002410-2zi5iv2t	75	4	specific	specific	JJ
cord-002410-2zi5iv2t	75	5	for	for	IN
cord-002410-2zi5iv2t	75	6	the	the	DT
cord-002410-2zi5iv2t	75	7	IFNL	IFNL	NNP
cord-002410-2zi5iv2t	75	8	receptor	receptor	NN
cord-002410-2zi5iv2t	75	9	(	(	-LRB-
cord-002410-2zi5iv2t	75	10	IFNLR	IFNLR	NNP
cord-002410-2zi5iv2t	75	11	)	)	-RRB-
cord-002410-2zi5iv2t	75	12	,	,	,
cord-002410-2zi5iv2t	75	13	while	while	IN
cord-002410-2zi5iv2t	75	14	the	the	DT
cord-002410-2zi5iv2t	75	15	latter	latter	NN
cord-002410-2zi5iv2t	75	16	is	be	VBZ
cord-002410-2zi5iv2t	75	17	shared	share	VBN
cord-002410-2zi5iv2t	75	18	with	with	IN
cord-002410-2zi5iv2t	75	19	the	the	DT
cord-002410-2zi5iv2t	75	20	type	type	NN
cord-002410-2zi5iv2t	75	21	II	II	NNP
cord-002410-2zi5iv2t	75	22	cytokine	cytokine	NN
cord-002410-2zi5iv2t	75	23	receptors	receptor	NNS
cord-002410-2zi5iv2t	75	24	for	for	IN
cord-002410-2zi5iv2t	75	25	IL-10	IL-10	NNP
cord-002410-2zi5iv2t	75	26	,	,	,
cord-002410-2zi5iv2t	75	27	IL-22	IL-22	NNP
cord-002410-2zi5iv2t	75	28	,	,	,
cord-002410-2zi5iv2t	75	29	and	and	CC
cord-002410-2zi5iv2t	75	30	IL-26	IL-26	NNP
cord-002410-2zi5iv2t	75	31	[	[	-LRB-
cord-002410-2zi5iv2t	75	32	45	45	CD
cord-002410-2zi5iv2t	75	33	]	]	-RRB-
cord-002410-2zi5iv2t	75	34	.	.	.
cord-002410-2zi5iv2t	76	1	Restricted	restricted	JJ
cord-002410-2zi5iv2t	76	2	expression	expression	NN
cord-002410-2zi5iv2t	76	3	of	of	IN
cord-002410-2zi5iv2t	76	4	the	the	DT
cord-002410-2zi5iv2t	76	5	IFNLR1	ifnlr1	NN
cord-002410-2zi5iv2t	76	6	subunit	subunit	NN
cord-002410-2zi5iv2t	76	7	leads	lead	VBZ
cord-002410-2zi5iv2t	76	8	to	to	IN
cord-002410-2zi5iv2t	76	9	a	a	DT
cord-002410-2zi5iv2t	76	10	tissue	tissue	NN
cord-002410-2zi5iv2t	76	11	specific	specific	JJ
cord-002410-2zi5iv2t	76	12	response	response	NN
cord-002410-2zi5iv2t	76	13	to	to	IN
cord-002410-2zi5iv2t	76	14	IFNLs	IFNLs	NNP
cord-002410-2zi5iv2t	76	15	.	.	.
cord-002410-2zi5iv2t	77	1	In	in	IN
cord-002410-2zi5iv2t	77	2	particular	particular	JJ
cord-002410-2zi5iv2t	77	3	tissues	tissue	NNS
cord-002410-2zi5iv2t	77	4	with	with	IN
cord-002410-2zi5iv2t	77	5	high	high	JJ
cord-002410-2zi5iv2t	77	6	epithelial	epithelial	JJ
cord-002410-2zi5iv2t	77	7	cell	cell	NN
cord-002410-2zi5iv2t	77	8	content	content	NN
cord-002410-2zi5iv2t	77	9	like	like	IN
cord-002410-2zi5iv2t	77	10	intestine	intestine	NN
cord-002410-2zi5iv2t	77	11	,	,	,
cord-002410-2zi5iv2t	77	12	liver	liver	NN
cord-002410-2zi5iv2t	77	13	,	,	,
cord-002410-2zi5iv2t	77	14	and	and	CC
cord-002410-2zi5iv2t	77	15	lung	lung	NNP
cord-002410-2zi5iv2t	77	16	express	express	NNP
cord-002410-2zi5iv2t	77	17	IFNLR1	IFNLR1	NNP
cord-002410-2zi5iv2t	77	18	and	and	CC
cord-002410-2zi5iv2t	77	19	respond	respond	VB
cord-002410-2zi5iv2t	77	20	to	to	IN
cord-002410-2zi5iv2t	77	21	IFNLs	IFNLs	NNP
cord-002410-2zi5iv2t	77	22	[	[	-LRB-
cord-002410-2zi5iv2t	77	23	46	46	CD
cord-002410-2zi5iv2t	77	24	]	]	-RRB-
cord-002410-2zi5iv2t	77	25	.	.	.
cord-002410-2zi5iv2t	78	1	Apart	apart	RB
cord-002410-2zi5iv2t	78	2	from	from	IN
cord-002410-2zi5iv2t	78	3	primary	primary	JJ
cord-002410-2zi5iv2t	78	4	human	human	JJ
cord-002410-2zi5iv2t	78	5	hepatocytes	hepatocyte	NNS
cord-002410-2zi5iv2t	78	6	,	,	,
cord-002410-2zi5iv2t	78	7	hepatocellular	hepatocellular	JJ
cord-002410-2zi5iv2t	78	8	carcinoma	carcinoma	NN
cord-002410-2zi5iv2t	78	9	cell	cell	NN
cord-002410-2zi5iv2t	78	10	lines	line	NNS
cord-002410-2zi5iv2t	78	11	including	include	VBG
cord-002410-2zi5iv2t	78	12	Huh-7	Huh-7	NNP
cord-002410-2zi5iv2t	78	13	and	and	CC
cord-002410-2zi5iv2t	78	14	HepG2	HepG2	NNP
cord-002410-2zi5iv2t	78	15	cells	cell	NNS
cord-002410-2zi5iv2t	78	16	respond	respond	VBP
cord-002410-2zi5iv2t	78	17	to	to	IN
cord-002410-2zi5iv2t	78	18	IFNL	IFNL	NNP
cord-002410-2zi5iv2t	78	19	[	[	-LRB-
cord-002410-2zi5iv2t	78	20	14	14	CD
cord-002410-2zi5iv2t	78	21	,	,	,
cord-002410-2zi5iv2t	78	22	47	47	CD
cord-002410-2zi5iv2t	78	23	]	]	-RRB-
cord-002410-2zi5iv2t	78	24	.	.	.
cord-002410-2zi5iv2t	79	1	In	in	IN
cord-002410-2zi5iv2t	79	2	addition	addition	NN
cord-002410-2zi5iv2t	79	3	to	to	IN
cord-002410-2zi5iv2t	79	4	the	the	DT
cord-002410-2zi5iv2t	79	5	full	full	JJ
cord-002410-2zi5iv2t	79	6	length	length	NN
cord-002410-2zi5iv2t	80	1	IFNLR1	ifnlr1	RB
cord-002410-2zi5iv2t	80	2	,	,	,
cord-002410-2zi5iv2t	81	1	a	a	DT
cord-002410-2zi5iv2t	81	2	secreted	secrete	VBN
cord-002410-2zi5iv2t	81	3	form	form	NN
cord-002410-2zi5iv2t	81	4	lacking	lack	VBG
cord-002410-2zi5iv2t	81	5	exon	exon	NN
cord-002410-2zi5iv2t	81	6	VI	VI	NNP
cord-002410-2zi5iv2t	81	7	has	have	VBZ
cord-002410-2zi5iv2t	81	8	been	be	VBN
cord-002410-2zi5iv2t	81	9	described	describe	VBN
cord-002410-2zi5iv2t	81	10	and	and	CC
cord-002410-2zi5iv2t	81	11	may	may	MD
cord-002410-2zi5iv2t	81	12	function	function	VB
cord-002410-2zi5iv2t	81	13	as	as	IN
cord-002410-2zi5iv2t	81	14	a	a	DT
cord-002410-2zi5iv2t	81	15	decoy	decoy	NN
cord-002410-2zi5iv2t	81	16	receptor	receptor	NN
cord-002410-2zi5iv2t	81	17	dampening	dampen	VBG
cord-002410-2zi5iv2t	81	18	IFNL	IFNL	NNP
cord-002410-2zi5iv2t	81	19	responses	response	NNS
cord-002410-2zi5iv2t	81	20	[	[	-LRB-
cord-002410-2zi5iv2t	81	21	2	2	CD
cord-002410-2zi5iv2t	81	22	,	,	,
cord-002410-2zi5iv2t	81	23	48	48	CD
cord-002410-2zi5iv2t	81	24	,	,	,
cord-002410-2zi5iv2t	81	25	49	49	CD
cord-002410-2zi5iv2t	81	26	]	]	-RRB-
cord-002410-2zi5iv2t	81	27	.	.	.
cord-002410-2zi5iv2t	82	1	The	the	DT
cord-002410-2zi5iv2t	82	2	IFNL	IFNL	NNP
cord-002410-2zi5iv2t	82	3	ligand	ligand	NN
cord-002410-2zi5iv2t	82	4	-	-	HYPH
cord-002410-2zi5iv2t	82	5	receptor	receptor	NN
cord-002410-2zi5iv2t	82	6	interface	interface	NN
cord-002410-2zi5iv2t	82	7	is	be	VBZ
cord-002410-2zi5iv2t	82	8	comprised	comprise	VBN
cord-002410-2zi5iv2t	82	9	of	of	IN
cord-002410-2zi5iv2t	82	10	helix	helix	NN
cord-002410-2zi5iv2t	82	11	A	A	NNP
cord-002410-2zi5iv2t	82	12	,	,	,
cord-002410-2zi5iv2t	82	13	loop	loop	NN
cord-002410-2zi5iv2t	82	14	AB	ab	NN
cord-002410-2zi5iv2t	82	15	,	,	,
cord-002410-2zi5iv2t	82	16	and	and	CC
cord-002410-2zi5iv2t	82	17	helix	helix	NN
cord-002410-2zi5iv2t	82	18	F	F	NNP
cord-002410-2zi5iv2t	82	19	for	for	IN
cord-002410-2zi5iv2t	82	20	IFNL	IFNL	NNP
cord-002410-2zi5iv2t	82	21	and	and	CC
cord-002410-2zi5iv2t	82	22	the	the	DT
cord-002410-2zi5iv2t	82	23	N	n	CD
cord-002410-2zi5iv2t	82	24	-	-	HYPH
cord-002410-2zi5iv2t	82	25	terminal	terminal	NN
cord-002410-2zi5iv2t	82	26	domain	domain	NN
cord-002410-2zi5iv2t	82	27	as	as	RB
cord-002410-2zi5iv2t	82	28	well	well	RB
cord-002410-2zi5iv2t	82	29	as	as	IN
cord-002410-2zi5iv2t	82	30	the	the	DT
cord-002410-2zi5iv2t	82	31	interdomain	interdomain	JJ
cord-002410-2zi5iv2t	82	32	hinge	hinge	NN
cord-002410-2zi5iv2t	82	33	region	region	NN
cord-002410-2zi5iv2t	82	34	for	for	IN
cord-002410-2zi5iv2t	82	35	the	the	DT
cord-002410-2zi5iv2t	82	36	IFNLR	IFNLR	NNP
cord-002410-2zi5iv2t	82	37	.	.	.
cord-002410-2zi5iv2t	83	1	Van	Van	NNP
cord-002410-2zi5iv2t	83	2	der	der	NNP
cord-002410-2zi5iv2t	83	3	Waals	Waals	NNP
cord-002410-2zi5iv2t	83	4	and	and	CC
cord-002410-2zi5iv2t	83	5	hydrophobic	hydrophobic	JJ
cord-002410-2zi5iv2t	83	6	forces	force	NNS
cord-002410-2zi5iv2t	83	7	determine	determine	VBP
cord-002410-2zi5iv2t	83	8	the	the	DT
cord-002410-2zi5iv2t	83	9	ligandreceptor	ligandreceptor	NN
cord-002410-2zi5iv2t	83	10	interaction	interaction	NN
cord-002410-2zi5iv2t	83	11	[	[	-LRB-
cord-002410-2zi5iv2t	83	12	40	40	CD
cord-002410-2zi5iv2t	83	13	]	]	-RRB-
cord-002410-2zi5iv2t	83	14	.	.	.
cord-002410-2zi5iv2t	84	1	Amino	amino	NN
cord-002410-2zi5iv2t	84	2	acids	acid	NNS
cord-002410-2zi5iv2t	84	3	critical	critical	JJ
cord-002410-2zi5iv2t	84	4	for	for	IN
cord-002410-2zi5iv2t	84	5	receptor	receptor	NN
cord-002410-2zi5iv2t	84	6	binding	bind	VBG
cord-002410-2zi5iv2t	84	7	differ	differ	NNS
cord-002410-2zi5iv2t	84	8	between	between	IN
cord-002410-2zi5iv2t	84	9	IFNL	IFNL	NNP
cord-002410-2zi5iv2t	84	10	subtypes	subtype	NNS
cord-002410-2zi5iv2t	84	11	and	and	CC
cord-002410-2zi5iv2t	84	12	this	this	DT
cord-002410-2zi5iv2t	84	13	might	may	MD
cord-002410-2zi5iv2t	84	14	lead	lead	VB
cord-002410-2zi5iv2t	84	15	to	to	IN
cord-002410-2zi5iv2t	84	16	different	different	JJ
cord-002410-2zi5iv2t	84	17	ligand	ligand	NN
cord-002410-2zi5iv2t	84	18	binding	bind	VBG
cord-002410-2zi5iv2t	84	19	affinities	affinity	NNS
cord-002410-2zi5iv2t	84	20	as	as	RB
cord-002410-2zi5iv2t	84	21	well	well	RB
cord-002410-2zi5iv2t	84	22	as	as	IN
cord-002410-2zi5iv2t	84	23	differences	difference	NNS
cord-002410-2zi5iv2t	84	24	in	in	IN
cord-002410-2zi5iv2t	84	25	the	the	DT
cord-002410-2zi5iv2t	84	26	stability	stability	NN
cord-002410-2zi5iv2t	84	27	of	of	IN
cord-002410-2zi5iv2t	84	28	the	the	DT
cord-002410-2zi5iv2t	84	29	ligand	ligand	NN
cord-002410-2zi5iv2t	84	30	-	-	HYPH
cord-002410-2zi5iv2t	84	31	receptor	receptor	NN
cord-002410-2zi5iv2t	84	32	complex	complex	NN
cord-002410-2zi5iv2t	84	33	[	[	-LRB-
cord-002410-2zi5iv2t	84	34	4	4	CD
cord-002410-2zi5iv2t	84	35	,	,	,
cord-002410-2zi5iv2t	84	36	50	50	CD
cord-002410-2zi5iv2t	84	37	]	]	-RRB-
cord-002410-2zi5iv2t	84	38	.	.	.
cord-002410-2zi5iv2t	85	1	Additionally	additionally	RB
cord-002410-2zi5iv2t	85	2	,	,	,
cord-002410-2zi5iv2t	85	3	mutations	mutation	NNS
cord-002410-2zi5iv2t	85	4	in	in	IN
cord-002410-2zi5iv2t	85	5	the	the	DT
cord-002410-2zi5iv2t	85	6	IFNL3	ifnl3	NN
cord-002410-2zi5iv2t	85	7	and	and	CC
cord-002410-2zi5iv2t	85	8	IFNL1	ifnl1	NN
cord-002410-2zi5iv2t	85	9	receptor	receptor	NN
cord-002410-2zi5iv2t	85	10	binding	bind	VBG
cord-002410-2zi5iv2t	85	11	sites	site	NNS
cord-002410-2zi5iv2t	85	12	Journal	Journal	NNP
cord-002410-2zi5iv2t	85	13	of	of	IN
cord-002410-2zi5iv2t	85	14	Immunology	Immunology	NNP
cord-002410-2zi5iv2t	85	15	Research	Research	NNP
cord-002410-2zi5iv2t	85	16	3	3	CD
cord-002410-2zi5iv2t	85	17	have	have	VBP
cord-002410-2zi5iv2t	85	18	been	be	VBN
cord-002410-2zi5iv2t	85	19	described	describe	VBN
cord-002410-2zi5iv2t	85	20	with	with	IN
cord-002410-2zi5iv2t	85	21	the	the	DT
cord-002410-2zi5iv2t	85	22	IFNL4	ifnl4	NN
cord-002410-2zi5iv2t	85	23	generating	generating	NN
cord-002410-2zi5iv2t	85	24	frameshift	frameshift	NN
cord-002410-2zi5iv2t	85	25	mutation	mutation	NN
cord-002410-2zi5iv2t	85	26	being	be	VBG
cord-002410-2zi5iv2t	85	27	the	the	DT
cord-002410-2zi5iv2t	85	28	best	good	JJS
cord-002410-2zi5iv2t	85	29	described	describe	VBN
cord-002410-2zi5iv2t	85	30	[	[	-LRB-
cord-002410-2zi5iv2t	85	31	40	40	CD
cord-002410-2zi5iv2t	85	32	,	,	,
cord-002410-2zi5iv2t	85	33	41	41	CD
cord-002410-2zi5iv2t	85	34	,	,	,
cord-002410-2zi5iv2t	85	35	50	50	CD
cord-002410-2zi5iv2t	85	36	]	]	-RRB-
cord-002410-2zi5iv2t	85	37	.	.	.
cord-002410-2zi5iv2t	86	1	The	the	DT
cord-002410-2zi5iv2t	86	2	impact	impact	NN
cord-002410-2zi5iv2t	86	3	of	of	IN
cord-002410-2zi5iv2t	86	4	these	these	DT
cord-002410-2zi5iv2t	86	5	genetic	genetic	JJ
cord-002410-2zi5iv2t	86	6	variants	variant	NNS
cord-002410-2zi5iv2t	86	7	is	be	VBZ
cord-002410-2zi5iv2t	86	8	discussed	discuss	VBN
cord-002410-2zi5iv2t	86	9	in	in	IN
cord-002410-2zi5iv2t	86	10	detail	detail	NN
cord-002410-2zi5iv2t	86	11	below	below	RB
cord-002410-2zi5iv2t	86	12	.	.	.
cord-002410-2zi5iv2t	87	1	Taken	take	VBN
cord-002410-2zi5iv2t	87	2	together	together	RB
cord-002410-2zi5iv2t	87	3	all	all	DT
cord-002410-2zi5iv2t	87	4	four	four	CD
cord-002410-2zi5iv2t	87	5	IFNL	IFNL	NNP
cord-002410-2zi5iv2t	87	6	proteins	protein	NNS
cord-002410-2zi5iv2t	87	7	share	share	VBP
cord-002410-2zi5iv2t	87	8	the	the	DT
cord-002410-2zi5iv2t	87	9	same	same	JJ
cord-002410-2zi5iv2t	87	10	cell	cell	NN
cord-002410-2zi5iv2t	87	11	surface	surface	NN
cord-002410-2zi5iv2t	87	12	receptor	receptor	NN
cord-002410-2zi5iv2t	87	13	,	,	,
cord-002410-2zi5iv2t	87	14	which	which	WDT
cord-002410-2zi5iv2t	87	15	is	be	VBZ
cord-002410-2zi5iv2t	87	16	primarily	primarily	RB
cord-002410-2zi5iv2t	87	17	expressed	express	VBN
cord-002410-2zi5iv2t	87	18	in	in	IN
cord-002410-2zi5iv2t	87	19	intestine	intestine	NN
cord-002410-2zi5iv2t	87	20	,	,	,
cord-002410-2zi5iv2t	87	21	lung	lung	NN
cord-002410-2zi5iv2t	87	22	,	,	,
cord-002410-2zi5iv2t	87	23	and	and	CC
cord-002410-2zi5iv2t	87	24	liver	liver	NN
cord-002410-2zi5iv2t	87	25	tissue	tissue	NN
cord-002410-2zi5iv2t	87	26	.	.	.
cord-002410-2zi5iv2t	88	1	Signaling	signal	VBG
cord-002410-2zi5iv2t	88	2	in	in	IN
cord-002410-2zi5iv2t	88	3	response	response	NN
cord-002410-2zi5iv2t	88	4	to	to	IN
cord-002410-2zi5iv2t	88	5	IFNLs	IFNLs	NNP
cord-002410-2zi5iv2t	88	6	is	be	VBZ
cord-002410-2zi5iv2t	88	7	initiated	initiate	VBN
cord-002410-2zi5iv2t	88	8	by	by	IN
cord-002410-2zi5iv2t	88	9	dimerization	dimerization	NN
cord-002410-2zi5iv2t	88	10	of	of	IN
cord-002410-2zi5iv2t	88	11	the	the	DT
cord-002410-2zi5iv2t	88	12	two	two	CD
cord-002410-2zi5iv2t	88	13	IFNLR	IFNLR	NNP
cord-002410-2zi5iv2t	88	14	subunits	subunit	NNS
cord-002410-2zi5iv2t	88	15	.	.	.
cord-002410-2zi5iv2t	89	1	Initial	initial	JJ
cord-002410-2zi5iv2t	89	2	binding	binding	NN
cord-002410-2zi5iv2t	89	3	of	of	IN
cord-002410-2zi5iv2t	89	4	IFNLs	ifnl	NNS
cord-002410-2zi5iv2t	89	5	to	to	TO
cord-002410-2zi5iv2t	89	6	IFNLR1	IFNLR1	NNP
cord-002410-2zi5iv2t	89	7	induces	induce	VBZ
cord-002410-2zi5iv2t	89	8	the	the	DT
cord-002410-2zi5iv2t	89	9	recruitment	recruitment	NN
cord-002410-2zi5iv2t	89	10	of	of	IN
cord-002410-2zi5iv2t	89	11	IL-10RB	IL-10RB	NNP
cord-002410-2zi5iv2t	89	12	,	,	,
cord-002410-2zi5iv2t	89	13	leading	lead	VBG
cord-002410-2zi5iv2t	89	14	to	to	IN
cord-002410-2zi5iv2t	89	15	the	the	DT
cord-002410-2zi5iv2t	89	16	activation	activation	NN
cord-002410-2zi5iv2t	89	17	of	of	IN
cord-002410-2zi5iv2t	89	18	the	the	DT
cord-002410-2zi5iv2t	89	19	receptor	receptor	NN
cord-002410-2zi5iv2t	89	20	associated	associate	VBD
cord-002410-2zi5iv2t	89	21	kinases	kinase	NNS
cord-002410-2zi5iv2t	89	22	Janus	Janus	NNP
cord-002410-2zi5iv2t	89	23	kinase	kinase	VBD
cord-002410-2zi5iv2t	89	24	1	1	CD
cord-002410-2zi5iv2t	89	25	(	(	-LRB-
cord-002410-2zi5iv2t	89	26	JAK1	JAK1	NNP
cord-002410-2zi5iv2t	89	27	)	)	-RRB-
cord-002410-2zi5iv2t	89	28	and	and	CC
cord-002410-2zi5iv2t	89	29	tyrosine	tyrosine	NN
cord-002410-2zi5iv2t	89	30	kinase	kinase	NN
cord-002410-2zi5iv2t	89	31	2	2	CD
cord-002410-2zi5iv2t	89	32	(	(	-LRB-
cord-002410-2zi5iv2t	89	33	TYK2	TYK2	NNP
cord-002410-2zi5iv2t	89	34	)	)	-RRB-
cord-002410-2zi5iv2t	89	35	.	.	.
cord-002410-2zi5iv2t	90	1	Cross	cross	NN
cord-002410-2zi5iv2t	90	2	-	-	JJ
cord-002410-2zi5iv2t	90	3	tyrosine	tyrosine	JJ
cord-002410-2zi5iv2t	90	4	phosphorylation	phosphorylation	NN
cord-002410-2zi5iv2t	90	5	of	of	IN
cord-002410-2zi5iv2t	90	6	the	the	DT
cord-002410-2zi5iv2t	90	7	IFNLR	IFNLR	NNP
cord-002410-2zi5iv2t	90	8	subsequently	subsequently	RB
cord-002410-2zi5iv2t	90	9	recruits	recruit	VBZ
cord-002410-2zi5iv2t	90	10	signal	signal	JJ
cord-002410-2zi5iv2t	90	11	transducer	transducer	NN
cord-002410-2zi5iv2t	90	12	and	and	CC
cord-002410-2zi5iv2t	90	13	activator	activator	NN
cord-002410-2zi5iv2t	90	14	of	of	IN
cord-002410-2zi5iv2t	90	15	transcriptions	transcription	NNS
cord-002410-2zi5iv2t	90	16	(	(	-LRB-
cord-002410-2zi5iv2t	90	17	STAT	stat	NN
cord-002410-2zi5iv2t	90	18	)	)	-RRB-
cord-002410-2zi5iv2t	90	19	1	1	CD
cord-002410-2zi5iv2t	90	20	and	and	CC
cord-002410-2zi5iv2t	90	21	2	2	CD
cord-002410-2zi5iv2t	90	22	to	to	IN
cord-002410-2zi5iv2t	90	23	the	the	DT
cord-002410-2zi5iv2t	90	24	receptor	receptor	NN
cord-002410-2zi5iv2t	90	25	platform	platform	NN
cord-002410-2zi5iv2t	90	26	.	.	.
cord-002410-2zi5iv2t	91	1	Phosphorylated	phosphorylated	JJ
cord-002410-2zi5iv2t	91	2	STAT1	stat1	NN
cord-002410-2zi5iv2t	91	3	and	and	CC
cord-002410-2zi5iv2t	91	4	STAT2	STAT2	NNS
cord-002410-2zi5iv2t	91	5	form	form	VBP
cord-002410-2zi5iv2t	91	6	a	a	DT
cord-002410-2zi5iv2t	91	7	heterotrimer	heterotrimer	NN
cord-002410-2zi5iv2t	91	8	together	together	RB
cord-002410-2zi5iv2t	91	9	with	with	IN
cord-002410-2zi5iv2t	91	10	IFN	IFN	NNP
cord-002410-2zi5iv2t	91	11	regulatory	regulatory	JJ
cord-002410-2zi5iv2t	91	12	factor	factor	NN
cord-002410-2zi5iv2t	91	13	9	9	CD
cord-002410-2zi5iv2t	92	1	(	(	-LRB-
cord-002410-2zi5iv2t	92	2	IRF9	IRF9	NNP
cord-002410-2zi5iv2t	92	3	)	)	-RRB-
cord-002410-2zi5iv2t	92	4	.	.	.
cord-002410-2zi5iv2t	93	1	This	this	DT
cord-002410-2zi5iv2t	93	2	trimeric	trimeric	RB
cord-002410-2zi5iv2t	93	3	complex	complex	NN
cord-002410-2zi5iv2t	93	4	,	,	,
cord-002410-2zi5iv2t	93	5	called	call	VBN
cord-002410-2zi5iv2t	93	6	IFNstimulated	ifnstimulate	VBN
cord-002410-2zi5iv2t	93	7	gene	gene	NN
cord-002410-2zi5iv2t	93	8	factor	factor	NN
cord-002410-2zi5iv2t	93	9	3	3	CD
cord-002410-2zi5iv2t	93	10	(	(	-LRB-
cord-002410-2zi5iv2t	93	11	ISGF3	ISGF3	NNP
cord-002410-2zi5iv2t	93	12	)	)	-RRB-
cord-002410-2zi5iv2t	93	13	,	,	,
cord-002410-2zi5iv2t	93	14	translocates	translocates	NNP
cord-002410-2zi5iv2t	93	15	to	to	IN
cord-002410-2zi5iv2t	93	16	the	the	DT
cord-002410-2zi5iv2t	93	17	nucleus	nucleus	NN
cord-002410-2zi5iv2t	93	18	where	where	WRB
cord-002410-2zi5iv2t	93	19	it	-PRON-	PRP
cord-002410-2zi5iv2t	93	20	binds	bind	VBZ
cord-002410-2zi5iv2t	93	21	to	to	IN
cord-002410-2zi5iv2t	93	22	the	the	DT
cord-002410-2zi5iv2t	93	23	IFN	IFN	NNP
cord-002410-2zi5iv2t	93	24	regulated	regulate	VBN
cord-002410-2zi5iv2t	93	25	response	response	NN
cord-002410-2zi5iv2t	93	26	element	element	NN
cord-002410-2zi5iv2t	93	27	(	(	-LRB-
cord-002410-2zi5iv2t	93	28	ISRE	ISRE	NNP
cord-002410-2zi5iv2t	93	29	)	)	-RRB-
cord-002410-2zi5iv2t	93	30	to	to	TO
cord-002410-2zi5iv2t	93	31	drive	drive	VB
cord-002410-2zi5iv2t	93	32	IFN	IFN	NNP
cord-002410-2zi5iv2t	93	33	-	-	HYPH
cord-002410-2zi5iv2t	93	34	stimulated	stimulate	VBN
cord-002410-2zi5iv2t	93	35	gene	gene	NN
cord-002410-2zi5iv2t	93	36	(	(	-LRB-
cord-002410-2zi5iv2t	93	37	ISG	ISG	NNP
cord-002410-2zi5iv2t	93	38	)	)	-RRB-
cord-002410-2zi5iv2t	93	39	expression	expression	NN
cord-002410-2zi5iv2t	93	40	[	[	-LRB-
cord-002410-2zi5iv2t	93	41	51	51	CD
cord-002410-2zi5iv2t	93	42	]	]	-RRB-
cord-002410-2zi5iv2t	93	43	.	.	.
cord-002410-2zi5iv2t	94	1	Antiviral	antiviral	JJ
cord-002410-2zi5iv2t	94	2	effects	effect	NNS
cord-002410-2zi5iv2t	94	3	of	of	IN
cord-002410-2zi5iv2t	94	4	IFNLs	ifnl	NNS
cord-002410-2zi5iv2t	94	5	are	be	VBP
cord-002410-2zi5iv2t	94	6	largely	largely	RB
cord-002410-2zi5iv2t	94	7	shared	share	VBN
cord-002410-2zi5iv2t	94	8	with	with	IN
cord-002410-2zi5iv2t	94	9	type	type	NN
cord-002410-2zi5iv2t	94	10	I	-PRON-	PRP
cord-002410-2zi5iv2t	94	11	IFNs	ifns	VBP
cord-002410-2zi5iv2t	94	12	.	.	.
cord-002410-2zi5iv2t	95	1	However	however	RB
cord-002410-2zi5iv2t	95	2	,	,	,
cord-002410-2zi5iv2t	95	3	differences	difference	NNS
cord-002410-2zi5iv2t	95	4	in	in	IN
cord-002410-2zi5iv2t	95	5	receptor	receptor	NN
cord-002410-2zi5iv2t	95	6	tissue	tissue	NN
cord-002410-2zi5iv2t	95	7	expression	expression	NN
cord-002410-2zi5iv2t	95	8	and	and	CC
cord-002410-2zi5iv2t	95	9	the	the	DT
cord-002410-2zi5iv2t	95	10	kinetics	kinetic	NNS
cord-002410-2zi5iv2t	95	11	of	of	IN
cord-002410-2zi5iv2t	95	12	STAT	STAT	NNP
cord-002410-2zi5iv2t	95	13	pathway	pathway	NN
cord-002410-2zi5iv2t	95	14	induction	induction	NN
cord-002410-2zi5iv2t	95	15	exist	exist	VBP
cord-002410-2zi5iv2t	95	16	between	between	IN
cord-002410-2zi5iv2t	95	17	the	the	DT
cord-002410-2zi5iv2t	95	18	two	two	CD
cord-002410-2zi5iv2t	95	19	IFN	IFN	NNP
cord-002410-2zi5iv2t	95	20	classes	class	NNS
cord-002410-2zi5iv2t	95	21	[	[	-LRB-
cord-002410-2zi5iv2t	95	22	52	52	CD
cord-002410-2zi5iv2t	95	23	]	]	-RRB-
cord-002410-2zi5iv2t	96	1	[	[	-LRB-
cord-002410-2zi5iv2t	96	2	53	53	CD
cord-002410-2zi5iv2t	96	3	]	]	-RRB-
cord-002410-2zi5iv2t	96	4	[	[	-LRB-
cord-002410-2zi5iv2t	96	5	54	54	CD
cord-002410-2zi5iv2t	96	6	]	]	-RRB-
cord-002410-2zi5iv2t	96	7	.	.	.
cord-002410-2zi5iv2t	97	1	In	in	IN
cord-002410-2zi5iv2t	97	2	Huh-7	Huh-7	NNP
cord-002410-2zi5iv2t	97	3	cells	cell	NNS
cord-002410-2zi5iv2t	97	4	,	,	,
cord-002410-2zi5iv2t	97	5	IFNL	IFNL	NNP
cord-002410-2zi5iv2t	97	6	induces	induce	VBZ
cord-002410-2zi5iv2t	97	7	a	a	DT
cord-002410-2zi5iv2t	97	8	slower	slow	JJR
cord-002410-2zi5iv2t	97	9	and	and	CC
cord-002410-2zi5iv2t	97	10	more	more	RBR
cord-002410-2zi5iv2t	97	11	sustained	sustained	JJ
cord-002410-2zi5iv2t	97	12	ISG	ISG	NNP
cord-002410-2zi5iv2t	97	13	response	response	NN
cord-002410-2zi5iv2t	97	14	[	[	-LRB-
cord-002410-2zi5iv2t	97	15	55	55	CD
cord-002410-2zi5iv2t	97	16	,	,	,
cord-002410-2zi5iv2t	97	17	56	56	CD
cord-002410-2zi5iv2t	97	18	]	]	-RRB-
cord-002410-2zi5iv2t	97	19	.	.	.
cord-002410-2zi5iv2t	98	1	Among	among	IN
cord-002410-2zi5iv2t	98	2	the	the	DT
cord-002410-2zi5iv2t	98	3	hundreds	hundred	NNS
cord-002410-2zi5iv2t	98	4	of	of	IN
cord-002410-2zi5iv2t	98	5	ISGs	isg	NNS
cord-002410-2zi5iv2t	98	6	induced	induce	VBN
cord-002410-2zi5iv2t	98	7	by	by	IN
cord-002410-2zi5iv2t	98	8	IFNLs	IFNLs	NNP
cord-002410-2zi5iv2t	98	9	and	and	CC
cord-002410-2zi5iv2t	98	10	type	type	NN
cord-002410-2zi5iv2t	99	1	I	-PRON-	PRP
cord-002410-2zi5iv2t	99	2	IFNs	ifn	NNS
cord-002410-2zi5iv2t	99	3	are	be	VBP
cord-002410-2zi5iv2t	99	4	ISG15	ISG15	NNP
cord-002410-2zi5iv2t	99	5	,	,	,
cord-002410-2zi5iv2t	99	6	myxovirus	myxovirus	NNP
cord-002410-2zi5iv2t	99	7	(	(	-LRB-
cord-002410-2zi5iv2t	99	8	influenza	influenza	NN
cord-002410-2zi5iv2t	99	9	virus	virus	NN
cord-002410-2zi5iv2t	99	10	)	)	-RRB-
cord-002410-2zi5iv2t	99	11	resistance	resistance	NN
cord-002410-2zi5iv2t	99	12	1	1	CD
cord-002410-2zi5iv2t	100	1	(	(	-LRB-
cord-002410-2zi5iv2t	100	2	MX1	MX1	NNP
cord-002410-2zi5iv2t	100	3	)	)	-RRB-
cord-002410-2zi5iv2t	100	4	,	,	,
cord-002410-2zi5iv2t	100	5	2	2	CD
cord-002410-2zi5iv2t	100	6	-5	-5	CD
cord-002410-2zi5iv2t	101	1	-oligoadenylate	-oligoadenylate	:
cord-002410-2zi5iv2t	101	2	synthetase	synthetase	NNP
cord-002410-2zi5iv2t	101	3	1	1	CD
cord-002410-2zi5iv2t	101	4	-	-	SYM
cord-002410-2zi5iv2t	101	5	3	3	CD
cord-002410-2zi5iv2t	102	1	(	(	-LRB-
cord-002410-2zi5iv2t	102	2	OAS-1	OAS-1	NNP
cord-002410-2zi5iv2t	102	3	-	-	HYPH
cord-002410-2zi5iv2t	102	4	3	3	NNP
cord-002410-2zi5iv2t	102	5	)	)	-RRB-
cord-002410-2zi5iv2t	102	6	,	,	,
cord-002410-2zi5iv2t	102	7	and	and	CC
cord-002410-2zi5iv2t	102	8	protein	protein	NN
cord-002410-2zi5iv2t	102	9	kinase	kinase	NN
cord-002410-2zi5iv2t	102	10	R	r	NN
cord-002410-2zi5iv2t	102	11	(	(	-LRB-
cord-002410-2zi5iv2t	102	12	PKR	PKR	NNP
cord-002410-2zi5iv2t	102	13	)	)	-RRB-
cord-002410-2zi5iv2t	102	14	.	.	.
cord-002410-2zi5iv2t	103	1	ISGs	ISGs	NNP
cord-002410-2zi5iv2t	103	2	interfere	interfere	VBP
cord-002410-2zi5iv2t	103	3	with	with	IN
cord-002410-2zi5iv2t	103	4	different	different	JJ
cord-002410-2zi5iv2t	103	5	stages	stage	NNS
cord-002410-2zi5iv2t	103	6	of	of	IN
cord-002410-2zi5iv2t	103	7	viral	viral	JJ
cord-002410-2zi5iv2t	103	8	life	life	NN
cord-002410-2zi5iv2t	103	9	cycles	cycle	NNS
cord-002410-2zi5iv2t	103	10	as	as	IN
cord-002410-2zi5iv2t	103	11	reviewed	review	VBN
cord-002410-2zi5iv2t	103	12	in	in	IN
cord-002410-2zi5iv2t	103	13	[	[	-LRB-
cord-002410-2zi5iv2t	103	14	57	57	CD
cord-002410-2zi5iv2t	103	15	]	]	-RRB-
cord-002410-2zi5iv2t	103	16	.	.	.
cord-002410-2zi5iv2t	104	1	The	the	DT
cord-002410-2zi5iv2t	104	2	anti	anti	JJ
cord-002410-2zi5iv2t	104	3	-	-	JJ
cord-002410-2zi5iv2t	104	4	inflammatory	inflammatory	JJ
cord-002410-2zi5iv2t	104	5	ISGs	isg	NNS
cord-002410-2zi5iv2t	104	6	USP18	usp18	JJ
cord-002410-2zi5iv2t	104	7	and	and	CC
cord-002410-2zi5iv2t	104	8	suppressor	suppressor	NN
cord-002410-2zi5iv2t	104	9	of	of	IN
cord-002410-2zi5iv2t	104	10	cytokine	cytokine	NN
cord-002410-2zi5iv2t	104	11	signaling	signal	VBG
cord-002410-2zi5iv2t	104	12	1	1	CD
cord-002410-2zi5iv2t	104	13	-	-	SYM
cord-002410-2zi5iv2t	104	14	3	3	CD
cord-002410-2zi5iv2t	104	15	(	(	-LRB-
cord-002410-2zi5iv2t	104	16	SOCS1	SOCS1	NNP
cord-002410-2zi5iv2t	104	17	-	-	HYPH
cord-002410-2zi5iv2t	104	18	3	3	CD
cord-002410-2zi5iv2t	104	19	)	)	-RRB-
cord-002410-2zi5iv2t	104	20	,	,	,
cord-002410-2zi5iv2t	104	21	however	however	RB
cord-002410-2zi5iv2t	104	22	,	,	,
cord-002410-2zi5iv2t	104	23	are	be	VBP
cord-002410-2zi5iv2t	104	24	specifically	specifically	RB
cord-002410-2zi5iv2t	104	25	induced	induce	VBN
cord-002410-2zi5iv2t	104	26	by	by	IN
cord-002410-2zi5iv2t	104	27	IFNLs	ifnl	NNS
cord-002410-2zi5iv2t	104	28	and	and	CC
cord-002410-2zi5iv2t	104	29	not	not	RB
cord-002410-2zi5iv2t	104	30	by	by	IN
cord-002410-2zi5iv2t	104	31	type	type	NN
cord-002410-2zi5iv2t	104	32	I	-PRON-	PRP
cord-002410-2zi5iv2t	104	33	IFNs	ifns	VBP
cord-002410-2zi5iv2t	104	34	[	[	-LRB-
cord-002410-2zi5iv2t	104	35	58	58	CD
cord-002410-2zi5iv2t	104	36	]	]	-RRB-
cord-002410-2zi5iv2t	104	37	.	.	.
cord-002410-2zi5iv2t	105	1	Both	both	DT
cord-002410-2zi5iv2t	105	2	proteins	protein	NNS
cord-002410-2zi5iv2t	105	3	interfere	interfere	VBP
cord-002410-2zi5iv2t	105	4	with	with	IN
cord-002410-2zi5iv2t	105	5	STAT	stat	NN
cord-002410-2zi5iv2t	105	6	signaling	signal	VBG
cord-002410-2zi5iv2t	105	7	and	and	CC
cord-002410-2zi5iv2t	105	8	therefore	therefore	RB
cord-002410-2zi5iv2t	105	9	lead	lead	VBP
cord-002410-2zi5iv2t	105	10	to	to	IN
cord-002410-2zi5iv2t	105	11	desensitization	desensitization	NN
cord-002410-2zi5iv2t	105	12	to	to	TO
cord-002410-2zi5iv2t	105	13	type	type	NN
cord-002410-2zi5iv2t	105	14	I	-PRON-	PRP
cord-002410-2zi5iv2t	105	15	IFNs	ifn	NNS
cord-002410-2zi5iv2t	105	16	and	and	CC
cord-002410-2zi5iv2t	105	17	IFNLs	ifnl	NNS
cord-002410-2zi5iv2t	105	18	[	[	-LRB-
cord-002410-2zi5iv2t	105	19	59	59	CD
cord-002410-2zi5iv2t	105	20	]	]	-RRB-
cord-002410-2zi5iv2t	106	1	[	[	-LRB-
cord-002410-2zi5iv2t	106	2	60	60	CD
cord-002410-2zi5iv2t	106	3	]	]	-RRB-
cord-002410-2zi5iv2t	106	4	[	[	-LRB-
cord-002410-2zi5iv2t	106	5	61	61	CD
cord-002410-2zi5iv2t	106	6	]	]	-RRB-
cord-002410-2zi5iv2t	106	7	.	.	.
cord-002410-2zi5iv2t	107	1	IFNL4	IFNL4	NNP
cord-002410-2zi5iv2t	107	2	additionally	additionally	RB
cord-002410-2zi5iv2t	107	3	induces	induce	VBZ
cord-002410-2zi5iv2t	107	4	expression	expression	NN
cord-002410-2zi5iv2t	107	5	of	of	IN
cord-002410-2zi5iv2t	107	6	rantes	rante	NNS
cord-002410-2zi5iv2t	107	7	and	and	CC
cord-002410-2zi5iv2t	107	8	fos	fos	NNP
cord-002410-2zi5iv2t	107	9	genes	gene	NNS
cord-002410-2zi5iv2t	107	10	in	in	IN
cord-002410-2zi5iv2t	107	11	hepatoma	hepatoma	NNP
cord-002410-2zi5iv2t	107	12	cells	cell	NNS
cord-002410-2zi5iv2t	107	13	[	[	-LRB-
cord-002410-2zi5iv2t	107	14	4	4	CD
cord-002410-2zi5iv2t	107	15	]	]	-RRB-
cord-002410-2zi5iv2t	107	16	.	.	.
cord-002410-2zi5iv2t	108	1	These	these	DT
cord-002410-2zi5iv2t	108	2	genes	gene	NNS
cord-002410-2zi5iv2t	108	3	are	be	VBP
cord-002410-2zi5iv2t	108	4	hallmarks	hallmark	NNS
cord-002410-2zi5iv2t	108	5	of	of	IN
cord-002410-2zi5iv2t	108	6	HCV	HCV	NNP
cord-002410-2zi5iv2t	108	7	-	-	HYPH
cord-002410-2zi5iv2t	108	8	induced	induce	VBN
cord-002410-2zi5iv2t	108	9	liver	liver	NN
cord-002410-2zi5iv2t	108	10	damage	damage	NN
cord-002410-2zi5iv2t	108	11	.	.	.
cord-002410-2zi5iv2t	109	1	Interestingly	interestingly	RB
cord-002410-2zi5iv2t	109	2	and	and	CC
cord-002410-2zi5iv2t	109	3	in	in	IN
cord-002410-2zi5iv2t	109	4	contrast	contrast	NN
cord-002410-2zi5iv2t	109	5	to	to	TO
cord-002410-2zi5iv2t	109	6	type	type	NN
cord-002410-2zi5iv2t	109	7	I	-PRON-	PRP
cord-002410-2zi5iv2t	109	8	INFs	inf	NNS
cord-002410-2zi5iv2t	109	9	,	,	,
cord-002410-2zi5iv2t	109	10	IFNLs	ifnl	NNS
cord-002410-2zi5iv2t	109	11	are	be	VBP
cord-002410-2zi5iv2t	109	12	themselves	-PRON-	PRP
cord-002410-2zi5iv2t	109	13	ISGs	isg	NNS
cord-002410-2zi5iv2t	109	14	as	as	IN
cord-002410-2zi5iv2t	109	15	IFN	IFN	NNP
cord-002410-2zi5iv2t	109	16	stimulation	stimulation	NN
cord-002410-2zi5iv2t	109	17	of	of	IN
cord-002410-2zi5iv2t	109	18	hepatoma	hepatoma	NNP
cord-002410-2zi5iv2t	109	19	cells	cell	NNS
cord-002410-2zi5iv2t	109	20	induces	induce	VBZ
cord-002410-2zi5iv2t	109	21	their	-PRON-	PRP$
cord-002410-2zi5iv2t	109	22	expression	expression	NN
cord-002410-2zi5iv2t	109	23	[	[	-LRB-
cord-002410-2zi5iv2t	109	24	11	11	CD
cord-002410-2zi5iv2t	109	25	]	]	-RRB-
cord-002410-2zi5iv2t	109	26	.	.	.
cord-002410-2zi5iv2t	110	1	Although	although	IN
cord-002410-2zi5iv2t	110	2	IFNL2	IFNL2	NNS
cord-002410-2zi5iv2t	110	3	and	and	CC
cord-002410-2zi5iv2t	110	4	IFNL3	IFNL3	NNS
cord-002410-2zi5iv2t	110	5	have	have	VBP
cord-002410-2zi5iv2t	110	6	high	high	JJ
cord-002410-2zi5iv2t	110	7	sequence	sequence	NN
cord-002410-2zi5iv2t	110	8	homology	homology	NN
cord-002410-2zi5iv2t	110	9	,	,	,
cord-002410-2zi5iv2t	110	10	they	-PRON-	PRP
cord-002410-2zi5iv2t	110	11	differ	differ	VBP
cord-002410-2zi5iv2t	110	12	in	in	IN
cord-002410-2zi5iv2t	110	13	their	-PRON-	PRP$
cord-002410-2zi5iv2t	110	14	antiviral	antiviral	JJ
cord-002410-2zi5iv2t	110	15	activity	activity	NN
cord-002410-2zi5iv2t	110	16	with	with	IN
cord-002410-2zi5iv2t	110	17	IFNL3	IFNL3	NNS
cord-002410-2zi5iv2t	110	18	displaying	display	VBG
cord-002410-2zi5iv2t	110	19	the	the	DT
cord-002410-2zi5iv2t	110	20	strongest	strong	JJS
cord-002410-2zi5iv2t	110	21	antiviral	antiviral	JJ
cord-002410-2zi5iv2t	110	22	activity	activity	NN
cord-002410-2zi5iv2t	110	23	in	in	IN
cord-002410-2zi5iv2t	110	24	a	a	DT
cord-002410-2zi5iv2t	110	25	HepG2	HepG2	NNP
cord-002410-2zi5iv2t	110	26	challenge	challenge	NN
cord-002410-2zi5iv2t	110	27	experiment	experiment	NN
cord-002410-2zi5iv2t	110	28	with	with	IN
cord-002410-2zi5iv2t	110	29	encephalomyocarditis	encephalomyocarditis	NNP
cord-002410-2zi5iv2t	110	30	virus	virus	NN
cord-002410-2zi5iv2t	110	31	[	[	-LRB-
cord-002410-2zi5iv2t	110	32	62	62	CD
cord-002410-2zi5iv2t	110	33	]	]	-RRB-
cord-002410-2zi5iv2t	110	34	.	.	.
cord-002410-2zi5iv2t	111	1	This	this	DT
cord-002410-2zi5iv2t	111	2	finding	finding	NN
cord-002410-2zi5iv2t	111	3	is	be	VBZ
cord-002410-2zi5iv2t	111	4	in	in	IN
cord-002410-2zi5iv2t	111	5	line	line	NN
cord-002410-2zi5iv2t	111	6	with	with	IN
cord-002410-2zi5iv2t	111	7	a	a	DT
cord-002410-2zi5iv2t	111	8	strong	strong	JJ
cord-002410-2zi5iv2t	111	9	ISG	ISG	NNP
cord-002410-2zi5iv2t	111	10	(	(	-LRB-
cord-002410-2zi5iv2t	111	11	MX1	MX1	NNP
cord-002410-2zi5iv2t	111	12	and	and	CC
cord-002410-2zi5iv2t	111	13	IRF9	IRF9	NNP
cord-002410-2zi5iv2t	111	14	)	)	-RRB-
cord-002410-2zi5iv2t	111	15	induction	induction	NN
cord-002410-2zi5iv2t	111	16	by	by	IN
cord-002410-2zi5iv2t	111	17	IFNL3	IFNL3	NNS
cord-002410-2zi5iv2t	111	18	in	in	IN
cord-002410-2zi5iv2t	111	19	hepatocytes	hepatocyte	NNS
cord-002410-2zi5iv2t	111	20	[	[	-LRB-
cord-002410-2zi5iv2t	111	21	55	55	CD
cord-002410-2zi5iv2t	111	22	]	]	-RRB-
cord-002410-2zi5iv2t	111	23	.	.	.
cord-002410-2zi5iv2t	112	1	IFNL4	ifnl4	RB
cord-002410-2zi5iv2t	112	2	,	,	,
cord-002410-2zi5iv2t	112	3	in	in	IN
cord-002410-2zi5iv2t	112	4	turn	turn	NN
cord-002410-2zi5iv2t	112	5	,	,	,
cord-002410-2zi5iv2t	112	6	displays	display	VBZ
cord-002410-2zi5iv2t	112	7	antiviral	antiviral	JJ
cord-002410-2zi5iv2t	112	8	activities	activity	NNS
cord-002410-2zi5iv2t	112	9	which	which	WDT
cord-002410-2zi5iv2t	112	10	are	be	VBP
cord-002410-2zi5iv2t	112	11	comparable	comparable	JJ
cord-002410-2zi5iv2t	112	12	to	to	IN
cord-002410-2zi5iv2t	112	13	IFNL3	IFNL3	NNP
cord-002410-2zi5iv2t	112	14	as	as	IN
cord-002410-2zi5iv2t	112	15	shown	show	VBN
cord-002410-2zi5iv2t	112	16	in	in	IN
cord-002410-2zi5iv2t	112	17	reporter	reporter	NN
cord-002410-2zi5iv2t	112	18	cells	cell	NNS
cord-002410-2zi5iv2t	112	19	expressing	express	VBG
cord-002410-2zi5iv2t	112	20	the	the	DT
cord-002410-2zi5iv2t	112	21	IFNLR	IFNLR	NNP
cord-002410-2zi5iv2t	112	22	and	and	CC
cord-002410-2zi5iv2t	112	23	a	a	DT
cord-002410-2zi5iv2t	112	24	luciferase	luciferase	NN
cord-002410-2zi5iv2t	112	25	gene	gene	NN
cord-002410-2zi5iv2t	112	26	under	under	IN
cord-002410-2zi5iv2t	112	27	the	the	DT
cord-002410-2zi5iv2t	112	28	control	control	NN
cord-002410-2zi5iv2t	112	29	of	of	IN
cord-002410-2zi5iv2t	112	30	the	the	DT
cord-002410-2zi5iv2t	112	31	IFI6	IFI6	NNP
cord-002410-2zi5iv2t	112	32	promoter	promoter	NN
cord-002410-2zi5iv2t	112	33	[	[	-LRB-
cord-002410-2zi5iv2t	112	34	3	3	CD
cord-002410-2zi5iv2t	112	35	]	]	-RRB-
cord-002410-2zi5iv2t	112	36	.	.	.
cord-002410-2zi5iv2t	113	1	In	in	IN
cord-002410-2zi5iv2t	113	2	conclusion	conclusion	NN
cord-002410-2zi5iv2t	113	3	,	,	,
cord-002410-2zi5iv2t	113	4	IFNLs	ifnls	CD
cord-002410-2zi5iv2t	113	5	signal	signal	NN
cord-002410-2zi5iv2t	113	6	through	through	IN
cord-002410-2zi5iv2t	113	7	the	the	DT
cord-002410-2zi5iv2t	113	8	JAK1	JAK1	NNP
cord-002410-2zi5iv2t	113	9	/	/	SYM
cord-002410-2zi5iv2t	113	10	STAT	stat	NN
cord-002410-2zi5iv2t	113	11	pathway	pathway	NN
cord-002410-2zi5iv2t	113	12	for	for	IN
cord-002410-2zi5iv2t	113	13	ISG	ISG	NNP
cord-002410-2zi5iv2t	113	14	induction	induction	NN
cord-002410-2zi5iv2t	113	15	and	and	CC
cord-002410-2zi5iv2t	113	16	the	the	DT
cord-002410-2zi5iv2t	113	17	set	set	NN
cord-002410-2zi5iv2t	113	18	of	of	IN
cord-002410-2zi5iv2t	113	19	ISGs	ISGs	NNPS
cord-002410-2zi5iv2t	113	20	largely	largely	RB
cord-002410-2zi5iv2t	113	21	overlaps	overlap	VBZ
cord-002410-2zi5iv2t	113	22	with	with	IN
cord-002410-2zi5iv2t	113	23	that	that	DT
cord-002410-2zi5iv2t	113	24	induced	induce	VBN
cord-002410-2zi5iv2t	113	25	by	by	IN
cord-002410-2zi5iv2t	113	26	type	type	NN
cord-002410-2zi5iv2t	113	27	I	-PRON-	PRP
cord-002410-2zi5iv2t	113	28	IFNs	ifns	VBP
cord-002410-2zi5iv2t	113	29	.	.	.
cord-002410-2zi5iv2t	114	1	to	to	IN
cord-002410-2zi5iv2t	114	2	the	the	DT
cord-002410-2zi5iv2t	114	3	genus	genus	NN
cord-002410-2zi5iv2t	114	4	Hepacivirus	Hepacivirus	NNP
cord-002410-2zi5iv2t	114	5	in	in	IN
cord-002410-2zi5iv2t	114	6	the	the	DT
cord-002410-2zi5iv2t	114	7	Flaviviridae	Flaviviridae	NNP
cord-002410-2zi5iv2t	114	8	family	family	NN
cord-002410-2zi5iv2t	114	9	.	.	.
cord-002410-2zi5iv2t	115	1	HCV	HCV	NNP
cord-002410-2zi5iv2t	115	2	is	be	VBZ
cord-002410-2zi5iv2t	115	3	an	an	DT
cord-002410-2zi5iv2t	115	4	enveloped	envelop	VBN
cord-002410-2zi5iv2t	115	5	virus	virus	NN
cord-002410-2zi5iv2t	115	6	with	with	IN
cord-002410-2zi5iv2t	115	7	a	a	DT
cord-002410-2zi5iv2t	115	8	single	single	RB
cord-002410-2zi5iv2t	115	9	-	-	HYPH
cord-002410-2zi5iv2t	115	10	stranded	stranded	JJ
cord-002410-2zi5iv2t	115	11	,	,	,
cord-002410-2zi5iv2t	115	12	positive	positive	JJ
cord-002410-2zi5iv2t	115	13	-	-	HYPH
cord-002410-2zi5iv2t	115	14	orientated	orientated	JJ
cord-002410-2zi5iv2t	115	15	RNA	RNA	NNP
cord-002410-2zi5iv2t	115	16	genome	genome	NN
cord-002410-2zi5iv2t	115	17	of	of	IN
cord-002410-2zi5iv2t	115	18	9.6	9.6	CD
cord-002410-2zi5iv2t	115	19	kbp	kbp	CD
cord-002410-2zi5iv2t	115	20	length	length	NN
cord-002410-2zi5iv2t	115	21	.	.	.
cord-002410-2zi5iv2t	116	1	According	accord	VBG
cord-002410-2zi5iv2t	116	2	to	to	IN
cord-002410-2zi5iv2t	116	3	genome	genome	NN
cord-002410-2zi5iv2t	116	4	sequence	sequence	NN
cord-002410-2zi5iv2t	116	5	diversity	diversity	NN
cord-002410-2zi5iv2t	116	6	HCV	HCV	NNP
cord-002410-2zi5iv2t	116	7	can	can	MD
cord-002410-2zi5iv2t	116	8	be	be	VB
cord-002410-2zi5iv2t	116	9	classified	classify	VBN
cord-002410-2zi5iv2t	116	10	into	into	IN
cord-002410-2zi5iv2t	116	11	seven	seven	CD
cord-002410-2zi5iv2t	116	12	genotypes	genotype	NNS
cord-002410-2zi5iv2t	116	13	and	and	CC
cord-002410-2zi5iv2t	116	14	multiple	multiple	JJ
cord-002410-2zi5iv2t	116	15	subtypes	subtype	NNS
cord-002410-2zi5iv2t	116	16	[	[	-LRB-
cord-002410-2zi5iv2t	116	17	63	63	CD
cord-002410-2zi5iv2t	116	18	]	]	-RRB-
cord-002410-2zi5iv2t	116	19	.	.	.
cord-002410-2zi5iv2t	117	1	The	the	DT
cord-002410-2zi5iv2t	117	2	liver	liver	NN
cord-002410-2zi5iv2t	117	3	tropic	tropic	NN
cord-002410-2zi5iv2t	117	4	virus	virus	NN
cord-002410-2zi5iv2t	117	5	enters	enter	VBZ
cord-002410-2zi5iv2t	117	6	hepatocytes	hepatocyte	NNS
cord-002410-2zi5iv2t	117	7	in	in	IN
cord-002410-2zi5iv2t	117	8	a	a	DT
cord-002410-2zi5iv2t	117	9	multistep	multistep	JJ
cord-002410-2zi5iv2t	117	10	process	process	NN
cord-002410-2zi5iv2t	117	11	involving	involve	VBG
cord-002410-2zi5iv2t	117	12	several	several	JJ
cord-002410-2zi5iv2t	117	13	host	host	NN
cord-002410-2zi5iv2t	117	14	cell	cell	NN
cord-002410-2zi5iv2t	117	15	proteins	protein	NNS
cord-002410-2zi5iv2t	117	16	(	(	-LRB-
cord-002410-2zi5iv2t	117	17	as	as	IN
cord-002410-2zi5iv2t	117	18	reviewed	review	VBN
cord-002410-2zi5iv2t	117	19	,	,	,
cord-002410-2zi5iv2t	117	20	e.g.	e.g.	RB
cord-002410-2zi5iv2t	117	21	,	,	,
cord-002410-2zi5iv2t	117	22	in	in	IN
cord-002410-2zi5iv2t	117	23	[	[	-LRB-
cord-002410-2zi5iv2t	117	24	64	64	CD
cord-002410-2zi5iv2t	117	25	]	]	-RRB-
cord-002410-2zi5iv2t	117	26	)	)	-RRB-
cord-002410-2zi5iv2t	117	27	.	.	.
cord-002410-2zi5iv2t	118	1	After	after	IN
cord-002410-2zi5iv2t	118	2	pH	ph	NN
cord-002410-2zi5iv2t	118	3	-	-	HYPH
cord-002410-2zi5iv2t	118	4	dependent	dependent	JJ
cord-002410-2zi5iv2t	118	5	fusion	fusion	NN
cord-002410-2zi5iv2t	118	6	of	of	IN
cord-002410-2zi5iv2t	118	7	the	the	DT
cord-002410-2zi5iv2t	118	8	viral	viral	JJ
cord-002410-2zi5iv2t	118	9	membrane	membrane	NN
cord-002410-2zi5iv2t	118	10	with	with	IN
cord-002410-2zi5iv2t	118	11	the	the	DT
cord-002410-2zi5iv2t	118	12	endosomal	endosomal	NNP
cord-002410-2zi5iv2t	118	13	membrane	membrane	NN
cord-002410-2zi5iv2t	118	14	,	,	,
cord-002410-2zi5iv2t	118	15	the	the	DT
cord-002410-2zi5iv2t	118	16	viral	viral	JJ
cord-002410-2zi5iv2t	118	17	genome	genome	NN
cord-002410-2zi5iv2t	118	18	is	be	VBZ
cord-002410-2zi5iv2t	118	19	released	release	VBN
cord-002410-2zi5iv2t	118	20	into	into	IN
cord-002410-2zi5iv2t	118	21	the	the	DT
cord-002410-2zi5iv2t	118	22	cytoplasm	cytoplasm	NN
cord-002410-2zi5iv2t	118	23	.	.	.
cord-002410-2zi5iv2t	119	1	There	there	RB
cord-002410-2zi5iv2t	119	2	the	the	DT
cord-002410-2zi5iv2t	119	3	positive	positive	JJ
cord-002410-2zi5iv2t	119	4	-	-	HYPH
cord-002410-2zi5iv2t	119	5	orientated	orientated	JJ
cord-002410-2zi5iv2t	119	6	RNA	RNA	NNP
cord-002410-2zi5iv2t	119	7	genome	genome	NN
cord-002410-2zi5iv2t	119	8	is	be	VBZ
cord-002410-2zi5iv2t	119	9	directly	directly	RB
cord-002410-2zi5iv2t	119	10	translated	translate	VBN
cord-002410-2zi5iv2t	119	11	into	into	IN
cord-002410-2zi5iv2t	119	12	a	a	DT
cord-002410-2zi5iv2t	119	13	single	single	JJ
cord-002410-2zi5iv2t	119	14	polyprotein	polyprotein	NN
cord-002410-2zi5iv2t	119	15	,	,	,
cord-002410-2zi5iv2t	119	16	which	which	WDT
cord-002410-2zi5iv2t	119	17	is	be	VBZ
cord-002410-2zi5iv2t	119	18	cleaved	cleave	VBN
cord-002410-2zi5iv2t	119	19	by	by	IN
cord-002410-2zi5iv2t	119	20	viral	viral	JJ
cord-002410-2zi5iv2t	119	21	and	and	CC
cord-002410-2zi5iv2t	119	22	cellular	cellular	JJ
cord-002410-2zi5iv2t	119	23	proteases	protease	NNS
cord-002410-2zi5iv2t	119	24	into	into	IN
cord-002410-2zi5iv2t	119	25	10	10	CD
cord-002410-2zi5iv2t	119	26	structural	structural	JJ
cord-002410-2zi5iv2t	119	27	and	and	CC
cord-002410-2zi5iv2t	119	28	nonstructural	nonstructural	JJ
cord-002410-2zi5iv2t	119	29	(	(	-LRB-
cord-002410-2zi5iv2t	119	30	NS	NS	NNP
cord-002410-2zi5iv2t	119	31	)	)	-RRB-
cord-002410-2zi5iv2t	119	32	proteins	protein	NNS
cord-002410-2zi5iv2t	119	33	.	.	.
cord-002410-2zi5iv2t	120	1	Replication	replication	NN
cord-002410-2zi5iv2t	120	2	and	and	CC
cord-002410-2zi5iv2t	120	3	virus	virus	NN
cord-002410-2zi5iv2t	120	4	assembly	assembly	NN
cord-002410-2zi5iv2t	120	5	occurs	occur	VBZ
cord-002410-2zi5iv2t	120	6	in	in	IN
cord-002410-2zi5iv2t	120	7	endoplasmic	endoplasmic	NN
cord-002410-2zi5iv2t	120	8	reticulum-(ER-	reticulum-(ER-	NNP
cord-002410-2zi5iv2t	120	9	)	)	-RRB-
cord-002410-2zi5iv2t	120	10	associated	associate	VBD
cord-002410-2zi5iv2t	120	11	membranous	membranous	JJ
cord-002410-2zi5iv2t	120	12	structures	structure	NNS
cord-002410-2zi5iv2t	120	13	,	,	,
cord-002410-2zi5iv2t	120	14	called	call	VBD
cord-002410-2zi5iv2t	120	15	the	the	DT
cord-002410-2zi5iv2t	120	16	membranous	membranous	JJ
cord-002410-2zi5iv2t	120	17	web	web	NN
cord-002410-2zi5iv2t	120	18	(	(	-LRB-
cord-002410-2zi5iv2t	120	19	MW	mw	NN
cord-002410-2zi5iv2t	120	20	)	)	-RRB-
cord-002410-2zi5iv2t	120	21	(	(	-LRB-
cord-002410-2zi5iv2t	120	22	as	as	IN
cord-002410-2zi5iv2t	120	23	reviewed	review	VBN
cord-002410-2zi5iv2t	120	24	,	,	,
cord-002410-2zi5iv2t	120	25	e.g.	e.g.	RB
cord-002410-2zi5iv2t	120	26	,	,	,
cord-002410-2zi5iv2t	120	27	in	in	IN
cord-002410-2zi5iv2t	120	28	[	[	-LRB-
cord-002410-2zi5iv2t	120	29	65	65	CD
cord-002410-2zi5iv2t	120	30	]	]	-RRB-
cord-002410-2zi5iv2t	120	31	)	)	-RRB-
cord-002410-2zi5iv2t	120	32	.	.	.
cord-002410-2zi5iv2t	121	1	HCV	HCV	NNP
cord-002410-2zi5iv2t	121	2	assembly	assembly	NN
cord-002410-2zi5iv2t	121	3	,	,	,
cord-002410-2zi5iv2t	121	4	maturation	maturation	NN
cord-002410-2zi5iv2t	121	5	,	,	,
cord-002410-2zi5iv2t	121	6	budding	budding	NN
cord-002410-2zi5iv2t	121	7	,	,	,
cord-002410-2zi5iv2t	121	8	and	and	CC
cord-002410-2zi5iv2t	121	9	release	release	NN
cord-002410-2zi5iv2t	121	10	occur	occur	VBP
cord-002410-2zi5iv2t	121	11	in	in	IN
cord-002410-2zi5iv2t	121	12	close	close	JJ
cord-002410-2zi5iv2t	121	13	contact	contact	NN
cord-002410-2zi5iv2t	121	14	with	with	IN
cord-002410-2zi5iv2t	121	15	the	the	DT
cord-002410-2zi5iv2t	121	16	cellular	cellular	JJ
cord-002410-2zi5iv2t	121	17	very	very	RB
cord-002410-2zi5iv2t	121	18	low	low	JJ
cord-002410-2zi5iv2t	121	19	density	density	NN
cord-002410-2zi5iv2t	121	20	lipoprotein	lipoprotein	NN
cord-002410-2zi5iv2t	121	21	synthesis	synthesis	NN
cord-002410-2zi5iv2t	121	22	pathway	pathway	NN
cord-002410-2zi5iv2t	121	23	.	.	.
cord-002410-2zi5iv2t	122	1	Nascent	nascent	JJ
cord-002410-2zi5iv2t	122	2	HCV	HCV	NNP
cord-002410-2zi5iv2t	122	3	particles	particle	NNS
cord-002410-2zi5iv2t	122	4	are	be	VBP
cord-002410-2zi5iv2t	122	5	released	release	VBN
cord-002410-2zi5iv2t	122	6	from	from	IN
cord-002410-2zi5iv2t	122	7	the	the	DT
cord-002410-2zi5iv2t	122	8	cells	cell	NNS
cord-002410-2zi5iv2t	122	9	via	via	IN
cord-002410-2zi5iv2t	122	10	the	the	DT
cord-002410-2zi5iv2t	122	11	secretory	secretory	JJ
cord-002410-2zi5iv2t	122	12	pathway	pathway	NN
cord-002410-2zi5iv2t	122	13	into	into	IN
cord-002410-2zi5iv2t	122	14	the	the	DT
cord-002410-2zi5iv2t	122	15	bloodstream	bloodstream	NN
cord-002410-2zi5iv2t	122	16	or	or	CC
cord-002410-2zi5iv2t	122	17	directly	directly	RB
cord-002410-2zi5iv2t	122	18	infect	infect	VB
cord-002410-2zi5iv2t	122	19	bystander	bystander	NN
cord-002410-2zi5iv2t	122	20	cells	cell	NNS
cord-002410-2zi5iv2t	122	21	(	(	-LRB-
cord-002410-2zi5iv2t	122	22	as	as	IN
cord-002410-2zi5iv2t	122	23	reviewed	review	VBN
cord-002410-2zi5iv2t	122	24	,	,	,
cord-002410-2zi5iv2t	122	25	e.g.	e.g.	RB
cord-002410-2zi5iv2t	122	26	,	,	,
cord-002410-2zi5iv2t	122	27	in	in	IN
cord-002410-2zi5iv2t	122	28	[	[	-LRB-
cord-002410-2zi5iv2t	122	29	64	64	CD
cord-002410-2zi5iv2t	122	30	]	]	-RRB-
cord-002410-2zi5iv2t	122	31	)	)	-RRB-
cord-002410-2zi5iv2t	122	32	.	.	.
cord-002410-2zi5iv2t	123	1	A	a	DT
cord-002410-2zi5iv2t	123	2	schematic	schematic	JJ
cord-002410-2zi5iv2t	123	3	overview	overview	NN
cord-002410-2zi5iv2t	123	4	of	of	IN
cord-002410-2zi5iv2t	123	5	the	the	DT
cord-002410-2zi5iv2t	123	6	HCV	HCV	NNP
cord-002410-2zi5iv2t	123	7	life	life	NN
cord-002410-2zi5iv2t	123	8	cycle	cycle	NN
cord-002410-2zi5iv2t	123	9	is	be	VBZ
cord-002410-2zi5iv2t	123	10	depicted	depict	VBN
cord-002410-2zi5iv2t	123	11	in	in	IN
cord-002410-2zi5iv2t	123	12	Figure	figure	NN
cord-002410-2zi5iv2t	123	13	2	2	CD
cord-002410-2zi5iv2t	123	14	.	.	.
cord-002410-2zi5iv2t	124	1	Worldwide	worldwide	IN
cord-002410-2zi5iv2t	124	2	92	92	CD
cord-002410-2zi5iv2t	124	3	-	-	SYM
cord-002410-2zi5iv2t	124	4	149	149	CD
cord-002410-2zi5iv2t	124	5	million	million	CD
cord-002410-2zi5iv2t	124	6	people	people	NNS
cord-002410-2zi5iv2t	124	7	,	,	,
cord-002410-2zi5iv2t	124	8	representing	represent	VBG
cord-002410-2zi5iv2t	124	9	approximately	approximately	RB
cord-002410-2zi5iv2t	124	10	2	2	CD
cord-002410-2zi5iv2t	124	11	%	%	NN
cord-002410-2zi5iv2t	124	12	of	of	IN
cord-002410-2zi5iv2t	124	13	the	the	DT
cord-002410-2zi5iv2t	124	14	world	world	NN
cord-002410-2zi5iv2t	124	15	's	's	POS
cord-002410-2zi5iv2t	124	16	population	population	NN
cord-002410-2zi5iv2t	124	17	,	,	,
cord-002410-2zi5iv2t	124	18	are	be	VBP
cord-002410-2zi5iv2t	124	19	chronically	chronically	RB
cord-002410-2zi5iv2t	124	20	infected	infect	VBN
cord-002410-2zi5iv2t	124	21	with	with	IN
cord-002410-2zi5iv2t	124	22	HCV	HCV	NNP
cord-002410-2zi5iv2t	124	23	[	[	-LRB-
cord-002410-2zi5iv2t	124	24	66	66	CD
cord-002410-2zi5iv2t	124	25	]	]	-RRB-
cord-002410-2zi5iv2t	124	26	,	,	,
cord-002410-2zi5iv2t	124	27	one	one	CD
cord-002410-2zi5iv2t	124	28	of	of	IN
cord-002410-2zi5iv2t	124	29	the	the	DT
cord-002410-2zi5iv2t	124	30	causative	causative	JJ
cord-002410-2zi5iv2t	124	31	agents	agent	NNS
cord-002410-2zi5iv2t	124	32	of	of	IN
cord-002410-2zi5iv2t	124	33	viral	viral	JJ
cord-002410-2zi5iv2t	124	34	hepatitis	hepatitis	NN
cord-002410-2zi5iv2t	124	35	.	.	.
cord-002410-2zi5iv2t	125	1	HCV	HCV	NNP
cord-002410-2zi5iv2t	125	2	is	be	VBZ
cord-002410-2zi5iv2t	125	3	a	a	DT
cord-002410-2zi5iv2t	125	4	blood	blood	NN
cord-002410-2zi5iv2t	125	5	borne	bear	VBN
cord-002410-2zi5iv2t	125	6	virus	virus	NN
cord-002410-2zi5iv2t	125	7	and	and	CC
cord-002410-2zi5iv2t	125	8	transmission	transmission	NN
cord-002410-2zi5iv2t	125	9	occurs	occur	VBZ
cord-002410-2zi5iv2t	125	10	parenterally	parenterally	RB
cord-002410-2zi5iv2t	125	11	,	,	,
cord-002410-2zi5iv2t	125	12	mainly	mainly	RB
cord-002410-2zi5iv2t	125	13	by	by	IN
cord-002410-2zi5iv2t	125	14	reusing	reuse	VBG
cord-002410-2zi5iv2t	125	15	injection	injection	NN
cord-002410-2zi5iv2t	125	16	material	material	NN
cord-002410-2zi5iv2t	125	17	,	,	,
cord-002410-2zi5iv2t	125	18	insufficient	insufficient	JJ
cord-002410-2zi5iv2t	125	19	sterilization	sterilization	NN
cord-002410-2zi5iv2t	125	20	of	of	IN
cord-002410-2zi5iv2t	125	21	medical	medical	JJ
cord-002410-2zi5iv2t	125	22	tools	tool	NNS
cord-002410-2zi5iv2t	125	23	,	,	,
cord-002410-2zi5iv2t	125	24	or	or	CC
cord-002410-2zi5iv2t	125	25	by	by	IN
cord-002410-2zi5iv2t	125	26	transfusion	transfusion	NN
cord-002410-2zi5iv2t	125	27	of	of	IN
cord-002410-2zi5iv2t	125	28	unscreened	unscreened	JJ
cord-002410-2zi5iv2t	125	29	blood	blood	NN
cord-002410-2zi5iv2t	125	30	or	or	CC
cord-002410-2zi5iv2t	125	31	blood	blood	NN
cord-002410-2zi5iv2t	125	32	products	product	NNS
cord-002410-2zi5iv2t	125	33	.	.	.
cord-002410-2zi5iv2t	126	1	As	as	IN
cord-002410-2zi5iv2t	126	2	screening	screening	NN
cord-002410-2zi5iv2t	126	3	of	of	IN
cord-002410-2zi5iv2t	126	4	blood	blood	NN
cord-002410-2zi5iv2t	126	5	products	product	NNS
cord-002410-2zi5iv2t	126	6	is	be	VBZ
cord-002410-2zi5iv2t	126	7	a	a	DT
cord-002410-2zi5iv2t	126	8	standard	standard	JJ
cord-002410-2zi5iv2t	126	9	procedure	procedure	NN
cord-002410-2zi5iv2t	126	10	nowadays	nowadays	RB
cord-002410-2zi5iv2t	126	11	in	in	IN
cord-002410-2zi5iv2t	126	12	most	most	JJS
cord-002410-2zi5iv2t	126	13	countries	country	NNS
cord-002410-2zi5iv2t	126	14	,	,	,
cord-002410-2zi5iv2t	126	15	people	people	NNS
cord-002410-2zi5iv2t	126	16	who	who	WP
cord-002410-2zi5iv2t	126	17	inject	inject	VBP
cord-002410-2zi5iv2t	126	18	drugs	drug	NNS
cord-002410-2zi5iv2t	126	19	have	have	VBP
cord-002410-2zi5iv2t	126	20	the	the	DT
cord-002410-2zi5iv2t	126	21	highest	high	JJS
cord-002410-2zi5iv2t	126	22	risk	risk	NN
cord-002410-2zi5iv2t	126	23	of	of	IN
cord-002410-2zi5iv2t	126	24	contracting	contract	VBG
cord-002410-2zi5iv2t	126	25	hepatitis	hepatitis	NN
cord-002410-2zi5iv2t	126	26	C.	C.	NNP
cord-002410-2zi5iv2t	127	1	In	in	IN
cord-002410-2zi5iv2t	127	2	fact	fact	NN
cord-002410-2zi5iv2t	127	3	,	,	,
cord-002410-2zi5iv2t	127	4	over	over	IN
cord-002410-2zi5iv2t	127	5	60	60	CD
cord-002410-2zi5iv2t	127	6	%	%	NN
cord-002410-2zi5iv2t	127	7	of	of	IN
cord-002410-2zi5iv2t	127	8	injecting	inject	VBG
cord-002410-2zi5iv2t	127	9	drug	drug	NN
cord-002410-2zi5iv2t	127	10	users	user	NNS
cord-002410-2zi5iv2t	127	11	are	be	VBP
cord-002410-2zi5iv2t	127	12	positive	positive	JJ
cord-002410-2zi5iv2t	127	13	for	for	IN
cord-002410-2zi5iv2t	127	14	HCVantibodies	hcvantibodie	NNS
cord-002410-2zi5iv2t	127	15	[	[	-LRB-
cord-002410-2zi5iv2t	127	16	67	67	CD
cord-002410-2zi5iv2t	127	17	]	]	-RRB-
cord-002410-2zi5iv2t	127	18	.	.	.
cord-002410-2zi5iv2t	128	1	Naturally	naturally	RB
cord-002410-2zi5iv2t	128	2	HCV	HCV	NNP
cord-002410-2zi5iv2t	128	3	infects	infect	VBZ
cord-002410-2zi5iv2t	128	4	only	only	RB
cord-002410-2zi5iv2t	128	5	humans	human	NNS
cord-002410-2zi5iv2t	128	6	,	,	,
cord-002410-2zi5iv2t	128	7	but	but	CC
cord-002410-2zi5iv2t	128	8	chimpanzees	chimpanzee	NNS
cord-002410-2zi5iv2t	128	9	can	can	MD
cord-002410-2zi5iv2t	128	10	be	be	VB
cord-002410-2zi5iv2t	128	11	experimentally	experimentally	RB
cord-002410-2zi5iv2t	128	12	infected	infect	VBN
cord-002410-2zi5iv2t	128	13	.	.	.
cord-002410-2zi5iv2t	129	1	In	in	IN
cord-002410-2zi5iv2t	129	2	both	both	DT
cord-002410-2zi5iv2t	129	3	cases	case	NNS
cord-002410-2zi5iv2t	129	4	,	,	,
cord-002410-2zi5iv2t	129	5	HCV	HCV	NNP
cord-002410-2zi5iv2t	129	6	targets	target	VBZ
cord-002410-2zi5iv2t	129	7	the	the	DT
cord-002410-2zi5iv2t	129	8	liver	liver	NN
cord-002410-2zi5iv2t	129	9	,	,	,
cord-002410-2zi5iv2t	129	10	in	in	IN
cord-002410-2zi5iv2t	129	11	particular	particular	JJ
cord-002410-2zi5iv2t	129	12	hepatocytes	hepatocyte	NNS
cord-002410-2zi5iv2t	129	13	.	.	.
cord-002410-2zi5iv2t	130	1	The	the	DT
cord-002410-2zi5iv2t	130	2	narrow	narrow	JJ
cord-002410-2zi5iv2t	130	3	host	host	NN
cord-002410-2zi5iv2t	130	4	range	range	NN
cord-002410-2zi5iv2t	130	5	is	be	VBZ
cord-002410-2zi5iv2t	130	6	determined	determine	VBN
cord-002410-2zi5iv2t	130	7	by	by	IN
cord-002410-2zi5iv2t	130	8	the	the	DT
cord-002410-2zi5iv2t	130	9	presence	presence	NN
cord-002410-2zi5iv2t	130	10	or	or	CC
cord-002410-2zi5iv2t	130	11	absence	absence	NN
cord-002410-2zi5iv2t	130	12	of	of	IN
cord-002410-2zi5iv2t	130	13	certain	certain	JJ
cord-002410-2zi5iv2t	130	14	host	host	NN
cord-002410-2zi5iv2t	130	15	cell	cell	NN
cord-002410-2zi5iv2t	130	16	factors	factor	NNS
cord-002410-2zi5iv2t	130	17	;	;	:
cord-002410-2zi5iv2t	130	18	proteins	protein	NNS
cord-002410-2zi5iv2t	130	19	critically	critically	RB
cord-002410-2zi5iv2t	130	20	needed	need	VBN
cord-002410-2zi5iv2t	130	21	for	for	IN
cord-002410-2zi5iv2t	130	22	HCV	HCV	NNP
cord-002410-2zi5iv2t	130	23	entry	entry	NN
cord-002410-2zi5iv2t	130	24	,	,	,
cord-002410-2zi5iv2t	130	25	like	like	IN
cord-002410-2zi5iv2t	130	26	the	the	DT
cord-002410-2zi5iv2t	130	27	cell	cell	NN
cord-002410-2zi5iv2t	130	28	surface	surface	NN
cord-002410-2zi5iv2t	130	29	receptors	receptor	NNS
cord-002410-2zi5iv2t	130	30	scavenger	scavenger	NN
cord-002410-2zi5iv2t	130	31	receptor	receptor	NN
cord-002410-2zi5iv2t	130	32	BI	BI	NNP
cord-002410-2zi5iv2t	130	33	(	(	-LRB-
cord-002410-2zi5iv2t	130	34	SRBI	SRBI	NNP
cord-002410-2zi5iv2t	130	35	)	)	-RRB-
cord-002410-2zi5iv2t	130	36	,	,	,
cord-002410-2zi5iv2t	130	37	CD81	CD81	NNP
cord-002410-2zi5iv2t	130	38	,	,	,
cord-002410-2zi5iv2t	130	39	claudin-1	claudin-1	NNP
cord-002410-2zi5iv2t	130	40	(	(	-LRB-
cord-002410-2zi5iv2t	130	41	CLDN1	CLDN1	NNP
cord-002410-2zi5iv2t	130	42	)	)	-RRB-
cord-002410-2zi5iv2t	130	43	,	,	,
cord-002410-2zi5iv2t	130	44	and	and	CC
cord-002410-2zi5iv2t	130	45	occludin	occludin	NNP
cord-002410-2zi5iv2t	130	46	(	(	-LRB-
cord-002410-2zi5iv2t	130	47	OCLN	OCLN	NNP
cord-002410-2zi5iv2t	130	48	)	)	-RRB-
cord-002410-2zi5iv2t	130	49	(	(	-LRB-
cord-002410-2zi5iv2t	130	50	as	as	IN
cord-002410-2zi5iv2t	130	51	reviewed	review	VBN
cord-002410-2zi5iv2t	130	52	,	,	,
cord-002410-2zi5iv2t	130	53	e.g.	e.g.	RB
cord-002410-2zi5iv2t	130	54	,	,	,
cord-002410-2zi5iv2t	130	55	in	in	IN
cord-002410-2zi5iv2t	130	56	[	[	-LRB-
cord-002410-2zi5iv2t	130	57	68	68	CD
cord-002410-2zi5iv2t	130	58	]	]	-RRB-
cord-002410-2zi5iv2t	130	59	)	)	-RRB-
cord-002410-2zi5iv2t	130	60	or	or	CC
cord-002410-2zi5iv2t	130	61	molecules	molecule	NNS
cord-002410-2zi5iv2t	130	62	needed	need	VBN
cord-002410-2zi5iv2t	130	63	for	for	IN
cord-002410-2zi5iv2t	130	64	viral	viral	JJ
cord-002410-2zi5iv2t	130	65	replication	replication	NN
cord-002410-2zi5iv2t	130	66	,	,	,
cord-002410-2zi5iv2t	130	67	like	like	IN
cord-002410-2zi5iv2t	130	68	microRNA	microRNA	NNP
cord-002410-2zi5iv2t	130	69	122	122	CD
cord-002410-2zi5iv2t	130	70	,	,	,
cord-002410-2zi5iv2t	130	71	are	be	VBP
cord-002410-2zi5iv2t	130	72	expressed	express	VBN
cord-002410-2zi5iv2t	130	73	in	in	IN
cord-002410-2zi5iv2t	130	74	hepatocytes	hepatocyte	NNS
cord-002410-2zi5iv2t	130	75	.	.	.
cord-002410-2zi5iv2t	131	1	On	on	IN
cord-002410-2zi5iv2t	131	2	the	the	DT
cord-002410-2zi5iv2t	131	3	other	other	JJ
cord-002410-2zi5iv2t	131	4	hand	hand	NN
cord-002410-2zi5iv2t	131	5	,	,	,
cord-002410-2zi5iv2t	131	6	proteins	protein	NNS
cord-002410-2zi5iv2t	131	7	suppressing	suppress	VBG
cord-002410-2zi5iv2t	131	8	HCV	HCV	NNP
cord-002410-2zi5iv2t	131	9	infection	infection	NN
cord-002410-2zi5iv2t	131	10	,	,	,
cord-002410-2zi5iv2t	131	11	like	like	IN
cord-002410-2zi5iv2t	131	12	EWI-2wint	EWI-2wint	NNP
cord-002410-2zi5iv2t	131	13	,	,	,
cord-002410-2zi5iv2t	131	14	are	be	VBP
cord-002410-2zi5iv2t	131	15	absent	absent	JJ
cord-002410-2zi5iv2t	131	16	in	in	IN
cord-002410-2zi5iv2t	131	17	hepatocytes	hepatocyte	NNS
cord-002410-2zi5iv2t	131	18	[	[	-LRB-
cord-002410-2zi5iv2t	131	19	69	69	CD
cord-002410-2zi5iv2t	131	20	]	]	-RRB-
cord-002410-2zi5iv2t	131	21	.	.	.
cord-002410-2zi5iv2t	132	1	After	after	IN
cord-002410-2zi5iv2t	132	2	acute	acute	JJ
cord-002410-2zi5iv2t	132	3	infection	infection	NN
cord-002410-2zi5iv2t	132	4	,	,	,
cord-002410-2zi5iv2t	132	5	which	which	WDT
cord-002410-2zi5iv2t	132	6	is	be	VBZ
cord-002410-2zi5iv2t	132	7	mainly	mainly	RB
cord-002410-2zi5iv2t	132	8	asymptomatic	asymptomatic	JJ
cord-002410-2zi5iv2t	132	9	,	,	,
cord-002410-2zi5iv2t	132	10	HCV	HCV	NNP
cord-002410-2zi5iv2t	132	11	establishes	establish	VBZ
cord-002410-2zi5iv2t	132	12	a	a	DT
cord-002410-2zi5iv2t	132	13	lifelong	lifelong	JJ
cord-002410-2zi5iv2t	132	14	,	,	,
cord-002410-2zi5iv2t	132	15	persistent	persistent	JJ
cord-002410-2zi5iv2t	132	16	intrahepatic	intrahepatic	JJ
cord-002410-2zi5iv2t	132	17	infection	infection	NN
cord-002410-2zi5iv2t	132	18	in	in	IN
cord-002410-2zi5iv2t	132	19	approximately	approximately	RB
cord-002410-2zi5iv2t	132	20	80	80	CD
cord-002410-2zi5iv2t	132	21	%	%	NN
cord-002410-2zi5iv2t	132	22	of	of	IN
cord-002410-2zi5iv2t	132	23	the	the	DT
cord-002410-2zi5iv2t	132	24	patients	patient	NNS
cord-002410-2zi5iv2t	132	25	.	.	.
cord-002410-2zi5iv2t	133	1	Development	development	NN
cord-002410-2zi5iv2t	133	2	of	of	IN
cord-002410-2zi5iv2t	133	3	chronic	chronic	JJ
cord-002410-2zi5iv2t	133	4	hepatitis	hepatitis	NN
cord-002410-2zi5iv2t	133	5	C	C	NNP
cord-002410-2zi5iv2t	133	6	(	(	-LRB-
cord-002410-2zi5iv2t	133	7	CHC	CHC	NNP
cord-002410-2zi5iv2t	133	8	)	)	-RRB-
cord-002410-2zi5iv2t	133	9	leads	lead	VBZ
cord-002410-2zi5iv2t	133	10	to	to	IN
cord-002410-2zi5iv2t	133	11	progressing	progress	VBG
cord-002410-2zi5iv2t	133	12	liver	liver	NN
cord-002410-2zi5iv2t	133	13	fibrosis	fibrosis	NN
cord-002410-2zi5iv2t	133	14	and	and	CC
cord-002410-2zi5iv2t	133	15	eventually	eventually	RB
cord-002410-2zi5iv2t	133	16	cirrhosis	cirrhosis	NN
cord-002410-2zi5iv2t	133	17	(	(	-LRB-
cord-002410-2zi5iv2t	133	18	15	15	CD
cord-002410-2zi5iv2t	133	19	-	-	SYM
cord-002410-2zi5iv2t	133	20	30	30	CD
cord-002410-2zi5iv2t	133	21	%	%	NN
cord-002410-2zi5iv2t	133	22	of	of	IN
cord-002410-2zi5iv2t	133	23	CHC	CHC	NNP
cord-002410-2zi5iv2t	133	24	patients	patient	NNS
cord-002410-2zi5iv2t	133	25	)	)	-RRB-
cord-002410-2zi5iv2t	133	26	,	,	,
cord-002410-2zi5iv2t	133	27	which	which	WDT
cord-002410-2zi5iv2t	133	28	can	can	MD
cord-002410-2zi5iv2t	133	29	cause	cause	VB
cord-002410-2zi5iv2t	133	30	liver	liver	NN
cord-002410-2zi5iv2t	133	31	failure	failure	NN
cord-002410-2zi5iv2t	133	32	or	or	CC
cord-002410-2zi5iv2t	133	33	the	the	DT
cord-002410-2zi5iv2t	133	34	development	development	NN
cord-002410-2zi5iv2t	133	35	of	of	IN
cord-002410-2zi5iv2t	133	36	hepatocellular	hepatocellular	JJ
cord-002410-2zi5iv2t	133	37	carcinoma	carcinoma	NN
cord-002410-2zi5iv2t	133	38	(	(	-LRB-
cord-002410-2zi5iv2t	133	39	2	2	CD
cord-002410-2zi5iv2t	133	40	-	-	SYM
cord-002410-2zi5iv2t	133	41	4	4	CD
cord-002410-2zi5iv2t	133	42	%	%	NN
cord-002410-2zi5iv2t	133	43	of	of	IN
cord-002410-2zi5iv2t	133	44	CHC	CHC	NNP
cord-002410-2zi5iv2t	133	45	induced	induce	VBD
cord-002410-2zi5iv2t	133	46	cirrhosis	cirrhosis	NN
cord-002410-2zi5iv2t	133	47	patients	patient	NNS
cord-002410-2zi5iv2t	133	48	per	per	IN
cord-002410-2zi5iv2t	133	49	year	year	NN
cord-002410-2zi5iv2t	133	50	)	)	-RRB-
cord-002410-2zi5iv2t	134	1	[	[	-LRB-
cord-002410-2zi5iv2t	134	2	70	70	CD
cord-002410-2zi5iv2t	134	3	]	]	-RRB-
cord-002410-2zi5iv2t	134	4	.	.	.
cord-002410-2zi5iv2t	135	1	Consequently	consequently	RB
cord-002410-2zi5iv2t	135	2	,	,	,
cord-002410-2zi5iv2t	135	3	HCV	HCV	NNP
cord-002410-2zi5iv2t	135	4	causes	cause	VBZ
cord-002410-2zi5iv2t	135	5	app	app	NN
cord-002410-2zi5iv2t	135	6	.	.	.
cord-002410-2zi5iv2t	136	1	700,000	700,000	CD
cord-002410-2zi5iv2t	136	2	deaths	death	NNS
cord-002410-2zi5iv2t	136	3	per	per	IN
cord-002410-2zi5iv2t	136	4	year	year	NN
cord-002410-2zi5iv2t	136	5	[	[	-LRB-
cord-002410-2zi5iv2t	136	6	70	70	CD
cord-002410-2zi5iv2t	136	7	]	]	-RRB-
cord-002410-2zi5iv2t	136	8	.	.	.
cord-002410-2zi5iv2t	137	1	CHC	CHC	NNP
cord-002410-2zi5iv2t	137	2	was	be	VBD
cord-002410-2zi5iv2t	137	3	classically	classically	RB
cord-002410-2zi5iv2t	137	4	treated	treat	VBN
cord-002410-2zi5iv2t	137	5	with	with	IN
cord-002410-2zi5iv2t	137	6	recombinant	recombinant	JJ
cord-002410-2zi5iv2t	137	7	PEG	peg	NN
cord-002410-2zi5iv2t	137	8	-	-	HYPH
cord-002410-2zi5iv2t	137	9	IFNalpha	ifnalpha	NN
cord-002410-2zi5iv2t	137	10	in	in	IN
cord-002410-2zi5iv2t	137	11	combination	combination	NN
cord-002410-2zi5iv2t	137	12	with	with	IN
cord-002410-2zi5iv2t	137	13	Ribavirin	Ribavirin	NNP
cord-002410-2zi5iv2t	137	14	(	(	-LRB-
cord-002410-2zi5iv2t	137	15	RBV	RBV	NNP
cord-002410-2zi5iv2t	137	16	)	)	-RRB-
cord-002410-2zi5iv2t	137	17	.	.	.
cord-002410-2zi5iv2t	138	1	The	the	DT
cord-002410-2zi5iv2t	138	2	treatment	treatment	NN
cord-002410-2zi5iv2t	138	3	duration	duration	NN
cord-002410-2zi5iv2t	138	4	was	be	VBD
cord-002410-2zi5iv2t	138	5	long	long	JJ
cord-002410-2zi5iv2t	138	6	(	(	-LRB-
cord-002410-2zi5iv2t	138	7	24	24	CD
cord-002410-2zi5iv2t	138	8	-	-	SYM
cord-002410-2zi5iv2t	138	9	48	48	CD
cord-002410-2zi5iv2t	138	10	weeks	week	NNS
cord-002410-2zi5iv2t	138	11	)	)	-RRB-
cord-002410-2zi5iv2t	138	12	and	and	CC
cord-002410-2zi5iv2t	138	13	wearing	wear	VBG
cord-002410-2zi5iv2t	138	14	,	,	,
cord-002410-2zi5iv2t	138	15	with	with	IN
cord-002410-2zi5iv2t	138	16	PEG	PEG	NNP
cord-002410-2zi5iv2t	138	17	-	-	HYPH
cord-002410-2zi5iv2t	138	18	IFN	IFN	NNP
cord-002410-2zi5iv2t	138	19	-	-	HYPH
cord-002410-2zi5iv2t	138	20	alpha	alpha	NN
cord-002410-2zi5iv2t	138	21	being	being	NN
cord-002410-2zi5iv2t	138	22	administered	administer	VBN
cord-002410-2zi5iv2t	138	23	3	3	CD
cord-002410-2zi5iv2t	138	24	times	time	NNS
cord-002410-2zi5iv2t	138	25	a	a	DT
cord-002410-2zi5iv2t	138	26	week	week	NN
cord-002410-2zi5iv2t	138	27	,	,	,
cord-002410-2zi5iv2t	138	28	severe	severe	JJ
cord-002410-2zi5iv2t	138	29	side	side	NN
cord-002410-2zi5iv2t	138	30	effects	effect	NNS
cord-002410-2zi5iv2t	138	31	occurring	occur	VBG
cord-002410-2zi5iv2t	138	32	frequently	frequently	RB
cord-002410-2zi5iv2t	138	33	,	,	,
cord-002410-2zi5iv2t	138	34	and	and	CC
cord-002410-2zi5iv2t	138	35	still	still	RB
cord-002410-2zi5iv2t	138	36	only	only	RB
cord-002410-2zi5iv2t	138	37	approximately	approximately	RB
cord-002410-2zi5iv2t	138	38	half	half	NN
cord-002410-2zi5iv2t	138	39	of	of	IN
cord-002410-2zi5iv2t	138	40	the	the	DT
cord-002410-2zi5iv2t	138	41	patients	patient	NNS
cord-002410-2zi5iv2t	138	42	being	be	VBG
cord-002410-2zi5iv2t	138	43	cured	cure	VBN
cord-002410-2zi5iv2t	138	44	.	.	.
cord-002410-2zi5iv2t	139	1	Since	since	IN
cord-002410-2zi5iv2t	139	2	2014	2014	CD
cord-002410-2zi5iv2t	139	3	HCV	HCV	NNP
cord-002410-2zi5iv2t	139	4	therapy	therapy	NN
cord-002410-2zi5iv2t	139	5	improved	improve	VBD
cord-002410-2zi5iv2t	139	6	drastically	drastically	RB
cord-002410-2zi5iv2t	139	7	,	,	,
cord-002410-2zi5iv2t	139	8	as	as	IN
cord-002410-2zi5iv2t	139	9	several	several	JJ
cord-002410-2zi5iv2t	139	10	direct	direct	JJ
cord-002410-2zi5iv2t	139	11	acting	act	VBG
cord-002410-2zi5iv2t	139	12	antivirals	antiviral	NNS
cord-002410-2zi5iv2t	139	13	targeting	target	VBG
cord-002410-2zi5iv2t	139	14	HCV	HCV	NNP
cord-002410-2zi5iv2t	139	15	NS3/4A	ns3/4a	NN
cord-002410-2zi5iv2t	139	16	protease	protease	NN
cord-002410-2zi5iv2t	139	17	,	,	,
cord-002410-2zi5iv2t	139	18	NS5A	NS5A	NNP
cord-002410-2zi5iv2t	139	19	,	,	,
cord-002410-2zi5iv2t	139	20	or	or	CC
cord-002410-2zi5iv2t	139	21	NS5B	NS5B	NNP
cord-002410-2zi5iv2t	139	22	RNA	RNA	NNP
cord-002410-2zi5iv2t	139	23	-	-	HYPH
cord-002410-2zi5iv2t	139	24	polymerase	polymerase	NNP
cord-002410-2zi5iv2t	139	25	were	be	VBD
cord-002410-2zi5iv2t	139	26	approved	approve	VBN
cord-002410-2zi5iv2t	139	27	.	.	.
cord-002410-2zi5iv2t	140	1	These	these	DT
cord-002410-2zi5iv2t	140	2	inhibitors	inhibitor	NNS
cord-002410-2zi5iv2t	140	3	,	,	,
cord-002410-2zi5iv2t	140	4	either	either	CC
cord-002410-2zi5iv2t	140	5	alone	alone	RB
cord-002410-2zi5iv2t	140	6	or	or	CC
cord-002410-2zi5iv2t	140	7	in	in	IN
cord-002410-2zi5iv2t	140	8	combination	combination	NN
cord-002410-2zi5iv2t	140	9	with	with	IN
cord-002410-2zi5iv2t	140	10	RBV	RBV	NNP
cord-002410-2zi5iv2t	140	11	,	,	,
cord-002410-2zi5iv2t	140	12	now	now	RB
cord-002410-2zi5iv2t	140	13	heal	heal	VB
cord-002410-2zi5iv2t	140	14	over	over	IN
cord-002410-2zi5iv2t	140	15	90	90	CD
cord-002410-2zi5iv2t	140	16	%	%	NN
cord-002410-2zi5iv2t	140	17	of	of	IN
cord-002410-2zi5iv2t	140	18	patients	patient	NNS
cord-002410-2zi5iv2t	140	19	treated	treat	VBN
cord-002410-2zi5iv2t	140	20	.	.	.
cord-002410-2zi5iv2t	141	1	Direct	direct	JJ
cord-002410-2zi5iv2t	141	2	acting	acting	NN
cord-002410-2zi5iv2t	141	3	antivirals	antiviral	NNS
cord-002410-2zi5iv2t	141	4	(	(	-LRB-
cord-002410-2zi5iv2t	141	5	DAAs	DAAs	NNP
cord-002410-2zi5iv2t	141	6	)	)	-RRB-
cord-002410-2zi5iv2t	141	7	are	be	VBP
cord-002410-2zi5iv2t	141	8	more	more	RBR
cord-002410-2zi5iv2t	141	9	effective	effective	JJ
cord-002410-2zi5iv2t	141	10	than	than	IN
cord-002410-2zi5iv2t	141	11	PEG	PEG	NNP
cord-002410-2zi5iv2t	141	12	-	-	HYPH
cord-002410-2zi5iv2t	141	13	IFN	IFN	NNP
cord-002410-2zi5iv2t	141	14	-	-	HYPH
cord-002410-2zi5iv2t	141	15	alpha	alpha	NN
cord-002410-2zi5iv2t	141	16	in	in	IN
cord-002410-2zi5iv2t	141	17	eliminating	eliminate	VBG
cord-002410-2zi5iv2t	141	18	HCV	HCV	NNP
cord-002410-2zi5iv2t	141	19	,	,	,
cord-002410-2zi5iv2t	141	20	but	but	CC
cord-002410-2zi5iv2t	141	21	also	also	RB
cord-002410-2zi5iv2t	141	22	treatment	treatment	NN
cord-002410-2zi5iv2t	141	23	duration	duration	NN
cord-002410-2zi5iv2t	141	24	is	be	VBZ
cord-002410-2zi5iv2t	141	25	shorter	short	JJR
cord-002410-2zi5iv2t	141	26	(	(	-LRB-
cord-002410-2zi5iv2t	141	27	minimum	minimum	NN
cord-002410-2zi5iv2t	141	28	of	of	IN
cord-002410-2zi5iv2t	141	29	8	8	CD
cord-002410-2zi5iv2t	141	30	weeks	week	NNS
cord-002410-2zi5iv2t	141	31	)	)	-RRB-
cord-002410-2zi5iv2t	141	32	,	,	,
cord-002410-2zi5iv2t	141	33	they	-PRON-	PRP
cord-002410-2zi5iv2t	141	34	can	can	MD
cord-002410-2zi5iv2t	141	35	be	be	VB
cord-002410-2zi5iv2t	141	36	administered	administer	VBN
cord-002410-2zi5iv2t	141	37	orally	orally	RB
cord-002410-2zi5iv2t	141	38	,	,	,
cord-002410-2zi5iv2t	141	39	and	and	CC
cord-002410-2zi5iv2t	141	40	adverse	adverse	JJ
cord-002410-2zi5iv2t	141	41	events	event	NNS
cord-002410-2zi5iv2t	141	42	are	be	VBP
cord-002410-2zi5iv2t	141	43	fewer	few	JJR
cord-002410-2zi5iv2t	141	44	.	.	.
cord-002410-2zi5iv2t	142	1	Despite	despite	IN
cord-002410-2zi5iv2t	142	2	advances	advance	NNS
cord-002410-2zi5iv2t	142	3	in	in	IN
cord-002410-2zi5iv2t	142	4	drug	drug	NN
cord-002410-2zi5iv2t	142	5	development	development	NN
cord-002410-2zi5iv2t	142	6	,	,	,
cord-002410-2zi5iv2t	142	7	a	a	DT
cord-002410-2zi5iv2t	142	8	vaccine	vaccine	NN
cord-002410-2zi5iv2t	142	9	against	against	IN
cord-002410-2zi5iv2t	142	10	HCV	HCV	NNP
cord-002410-2zi5iv2t	142	11	is	be	VBZ
cord-002410-2zi5iv2t	142	12	still	still	RB
cord-002410-2zi5iv2t	142	13	not	not	RB
cord-002410-2zi5iv2t	142	14	available	available	JJ
cord-002410-2zi5iv2t	142	15	.	.	.
cord-002410-2zi5iv2t	143	1	For	for	IN
cord-002410-2zi5iv2t	143	2	more	more	JJR
cord-002410-2zi5iv2t	143	3	details	detail	NNS
cord-002410-2zi5iv2t	143	4	we	-PRON-	PRP
cord-002410-2zi5iv2t	143	5	refer	refer	VBP
cord-002410-2zi5iv2t	143	6	the	the	DT
cord-002410-2zi5iv2t	143	7	reader	reader	NN
cord-002410-2zi5iv2t	143	8	elsewhere	elsewhere	RB
cord-002410-2zi5iv2t	143	9	,	,	,
cord-002410-2zi5iv2t	143	10	for	for	IN
cord-002410-2zi5iv2t	143	11	example	example	NN
cord-002410-2zi5iv2t	143	12	[	[	-LRB-
cord-002410-2zi5iv2t	143	13	71	71	CD
cord-002410-2zi5iv2t	143	14	,	,	,
cord-002410-2zi5iv2t	143	15	72	72	CD
cord-002410-2zi5iv2t	143	16	]	]	-RRB-
cord-002410-2zi5iv2t	143	17	.	.	.
cord-002410-2zi5iv2t	144	1	The	the	DT
cord-002410-2zi5iv2t	144	2	innate	innate	JJ
cord-002410-2zi5iv2t	144	3	immune	immune	JJ
cord-002410-2zi5iv2t	144	4	response	response	NN
cord-002410-2zi5iv2t	144	5	serves	serve	VBZ
cord-002410-2zi5iv2t	144	6	as	as	IN
cord-002410-2zi5iv2t	144	7	the	the	DT
cord-002410-2zi5iv2t	144	8	first	first	JJ
cord-002410-2zi5iv2t	144	9	line	line	NN
cord-002410-2zi5iv2t	144	10	of	of	IN
cord-002410-2zi5iv2t	144	11	defense	defense	NN
cord-002410-2zi5iv2t	144	12	against	against	IN
cord-002410-2zi5iv2t	144	13	infections	infection	NNS
cord-002410-2zi5iv2t	144	14	;	;	:
cord-002410-2zi5iv2t	144	15	pathogen	pathogen	NN
cord-002410-2zi5iv2t	144	16	associated	associate	VBD
cord-002410-2zi5iv2t	144	17	molecular	molecular	JJ
cord-002410-2zi5iv2t	144	18	patterns	pattern	NNS
cord-002410-2zi5iv2t	144	19	(	(	-LRB-
cord-002410-2zi5iv2t	144	20	PAMPs	pamp	NNS
cord-002410-2zi5iv2t	144	21	)	)	-RRB-
cord-002410-2zi5iv2t	144	22	are	be	VBP
cord-002410-2zi5iv2t	144	23	recognized	recognize	VBN
cord-002410-2zi5iv2t	144	24	by	by	IN
cord-002410-2zi5iv2t	144	25	extra	extra	JJ
cord-002410-2zi5iv2t	144	26	-	-	HYPH
cord-002410-2zi5iv2t	144	27	or	or	CC
cord-002410-2zi5iv2t	144	28	intracellular	intracellular	JJ
cord-002410-2zi5iv2t	144	29	pattern	pattern	NN
cord-002410-2zi5iv2t	144	30	recognition	recognition	NN
cord-002410-2zi5iv2t	144	31	receptors	receptor	NNS
cord-002410-2zi5iv2t	144	32	(	(	-LRB-
cord-002410-2zi5iv2t	144	33	PRRs	PRRs	NNP
cord-002410-2zi5iv2t	144	34	)	)	-RRB-
cord-002410-2zi5iv2t	144	35	,	,	,
cord-002410-2zi5iv2t	144	36	which	which	WDT
cord-002410-2zi5iv2t	144	37	triggers	trigger	VBZ
cord-002410-2zi5iv2t	144	38	signaling	signal	VBG
cord-002410-2zi5iv2t	144	39	cascades	cascade	NNS
cord-002410-2zi5iv2t	144	40	leading	lead	VBG
cord-002410-2zi5iv2t	144	41	to	to	IN
cord-002410-2zi5iv2t	144	42	the	the	DT
cord-002410-2zi5iv2t	144	43	production	production	NN
cord-002410-2zi5iv2t	144	44	of	of	IN
cord-002410-2zi5iv2t	144	45	cytokines	cytokine	NNS
cord-002410-2zi5iv2t	144	46	including	include	VBG
cord-002410-2zi5iv2t	144	47	interferons	interferon	NNS
cord-002410-2zi5iv2t	144	48	.	.	.
cord-002410-2zi5iv2t	145	1	The	the	DT
cord-002410-2zi5iv2t	145	2	innate	innate	JJ
cord-002410-2zi5iv2t	145	3	immune	immune	JJ
cord-002410-2zi5iv2t	145	4	response	response	NN
cord-002410-2zi5iv2t	145	5	to	to	IN
cord-002410-2zi5iv2t	145	6	HCV	HCV	NNP
cord-002410-2zi5iv2t	145	7	is	be	VBZ
cord-002410-2zi5iv2t	145	8	summarized	summarize	VBN
cord-002410-2zi5iv2t	145	9	in	in	IN
cord-002410-2zi5iv2t	145	10	Figure	Figure	NNP
cord-002410-2zi5iv2t	145	11	3	3	CD
cord-002410-2zi5iv2t	145	12	.	.	.
cord-002410-2zi5iv2t	146	1	In	in	IN
cord-002410-2zi5iv2t	146	2	HCV	HCV	NNP
cord-002410-2zi5iv2t	146	3	infected	infected	JJ
cord-002410-2zi5iv2t	146	4	cells	cell	NNS
cord-002410-2zi5iv2t	146	5	,	,	,
cord-002410-2zi5iv2t	146	6	double	double	RB
cord-002410-2zi5iv2t	146	7	-	-	HYPH
cord-002410-2zi5iv2t	146	8	stranded	stranded	JJ
cord-002410-2zi5iv2t	146	9	(	(	-LRB-
cord-002410-2zi5iv2t	146	10	ds	ds	NNP
cord-002410-2zi5iv2t	146	11	)	)	-RRB-
cord-002410-2zi5iv2t	146	12	RNA	RNA	NNP
cord-002410-2zi5iv2t	146	13	replication	replication	NN
cord-002410-2zi5iv2t	146	14	intermediates	intermediate	NNS
cord-002410-2zi5iv2t	146	15	are	be	VBP
cord-002410-2zi5iv2t	146	16	generated	generate	VBN
cord-002410-2zi5iv2t	146	17	and	and	CC
cord-002410-2zi5iv2t	146	18	recognized	recognize	VBN
cord-002410-2zi5iv2t	146	19	as	as	IN
cord-002410-2zi5iv2t	146	20	PAMPs	pamp	NNS
cord-002410-2zi5iv2t	146	21	by	by	IN
cord-002410-2zi5iv2t	146	22	the	the	DT
cord-002410-2zi5iv2t	146	23	cytosolic	cytosolic	JJ
cord-002410-2zi5iv2t	146	24	RNA	RNA	NNP
cord-002410-2zi5iv2t	146	25	sensor	sensor	NN
cord-002410-2zi5iv2t	146	26	retinoic	retinoic	JJ
cord-002410-2zi5iv2t	146	27	acid	acid	NN
cord-002410-2zi5iv2t	146	28	-	-	HYPH
cord-002410-2zi5iv2t	146	29	induced	induce	VBN
cord-002410-2zi5iv2t	146	30	gene	gene	NN
cord-002410-2zi5iv2t	147	1	I	-PRON-	PRP
cord-002410-2zi5iv2t	148	1	(	(	-LRB-
cord-002410-2zi5iv2t	148	2	RIG	rig	NN
cord-002410-2zi5iv2t	148	3	-	-	HYPH
cord-002410-2zi5iv2t	148	4	I	i	NN
cord-002410-2zi5iv2t	148	5	)	)	-RRB-
cord-002410-2zi5iv2t	148	6	[	[	-LRB-
cord-002410-2zi5iv2t	148	7	73	73	CD
cord-002410-2zi5iv2t	148	8	]	]	-RRB-
cord-002410-2zi5iv2t	148	9	and	and	CC
cord-002410-2zi5iv2t	148	10	melanoma	melanoma	NN
cord-002410-2zi5iv2t	148	11	differentiation	differentiation	NN
cord-002410-2zi5iv2t	148	12	-	-	HYPH
cord-002410-2zi5iv2t	148	13	associated	associate	VBN
cord-002410-2zi5iv2t	148	14	gene	gene	NN
cord-002410-2zi5iv2t	148	15	5	5	CD
cord-002410-2zi5iv2t	148	16	(	(	-LRB-
cord-002410-2zi5iv2t	148	17	MDA5	MDA5	NNP
cord-002410-2zi5iv2t	148	18	)	)	-RRB-
cord-002410-2zi5iv2t	149	1	[	[	-LRB-
cord-002410-2zi5iv2t	149	2	74	74	CD
cord-002410-2zi5iv2t	149	3	,	,	,
cord-002410-2zi5iv2t	149	4	75	75	CD
cord-002410-2zi5iv2t	149	5	]	]	-RRB-
cord-002410-2zi5iv2t	149	6	,	,	,
cord-002410-2zi5iv2t	149	7	both	both	DT
cord-002410-2zi5iv2t	149	8	belonging	belong	VBG
cord-002410-2zi5iv2t	149	9	to	to	IN
cord-002410-2zi5iv2t	149	10	the	the	DT
cord-002410-2zi5iv2t	149	11	family	family	NN
cord-002410-2zi5iv2t	149	12	of	of	IN
cord-002410-2zi5iv2t	149	13	RIG	rig	NN
cord-002410-2zi5iv2t	149	14	-	-	:
cord-002410-2zi5iv2t	149	15	I	-PRON-	PRP
cord-002410-2zi5iv2t	149	16	like	like	IN
cord-002410-2zi5iv2t	149	17	receptors	receptor	NNS
cord-002410-2zi5iv2t	149	18	(	(	-LRB-
cord-002410-2zi5iv2t	149	19	RLRs	rlr	NNS
cord-002410-2zi5iv2t	149	20	)	)	-RRB-
cord-002410-2zi5iv2t	149	21	.	.	.
cord-002410-2zi5iv2t	150	1	Sensing	sensing	NN
cord-002410-2zi5iv2t	150	2	of	of	IN
cord-002410-2zi5iv2t	150	3	HCV	HCV	NNP
cord-002410-2zi5iv2t	150	4	by	by	IN
cord-002410-2zi5iv2t	150	5	RIG	rig	NN
cord-002410-2zi5iv2t	150	6	-	-	:
cord-002410-2zi5iv2t	150	7	I	I	NNP
cord-002410-2zi5iv2t	150	8	or	or	CC
cord-002410-2zi5iv2t	150	9	MDA5	MDA5	NNP
cord-002410-2zi5iv2t	150	10	then	then	RB
cord-002410-2zi5iv2t	150	11	leads	lead	VBZ
cord-002410-2zi5iv2t	150	12	to	to	IN
cord-002410-2zi5iv2t	150	13	the	the	DT
cord-002410-2zi5iv2t	150	14	oligomerization	oligomerization	NN
cord-002410-2zi5iv2t	150	15	of	of	IN
cord-002410-2zi5iv2t	150	16	the	the	DT
cord-002410-2zi5iv2t	150	17	adaptor	adaptor	NN
cord-002410-2zi5iv2t	150	18	protein	protein	NN
cord-002410-2zi5iv2t	150	19	mitochondria	mitochondrion	NNS
cord-002410-2zi5iv2t	150	20	antiviral	antiviral	JJ
cord-002410-2zi5iv2t	150	21	signal	signal	NN
cord-002410-2zi5iv2t	150	22	(	(	-LRB-
cord-002410-2zi5iv2t	150	23	MAVS	mavs	RB
cord-002410-2zi5iv2t	150	24	;	;	:
cord-002410-2zi5iv2t	150	25	also	also	RB
cord-002410-2zi5iv2t	150	26	called	call	VBN
cord-002410-2zi5iv2t	150	27	CARDIF	CARDIF	NNP
cord-002410-2zi5iv2t	150	28	,	,	,
cord-002410-2zi5iv2t	150	29	VISA	VISA	NNP
cord-002410-2zi5iv2t	150	30	,	,	,
cord-002410-2zi5iv2t	150	31	IPS-1	IPS-1	NNP
cord-002410-2zi5iv2t	150	32	)	)	-RRB-
cord-002410-2zi5iv2t	150	33	into	into	IN
cord-002410-2zi5iv2t	150	34	large	large	JJ
cord-002410-2zi5iv2t	150	35	signaling	signal	VBG
cord-002410-2zi5iv2t	150	36	complexes	complex	NNS
cord-002410-2zi5iv2t	150	37	[	[	-LRB-
cord-002410-2zi5iv2t	150	38	76	76	CD
cord-002410-2zi5iv2t	150	39	]	]	-RRB-
cord-002410-2zi5iv2t	150	40	.	.	.
cord-002410-2zi5iv2t	151	1	Besides	besides	IN
cord-002410-2zi5iv2t	151	2	the	the	DT
cord-002410-2zi5iv2t	151	3	cytosol	cytosol	NN
cord-002410-2zi5iv2t	151	4	,	,	,
cord-002410-2zi5iv2t	151	5	HCV	HCV	NNP
cord-002410-2zi5iv2t	151	6	dsRNA	dsrna	NN
cord-002410-2zi5iv2t	151	7	can	can	MD
cord-002410-2zi5iv2t	151	8	also	also	RB
cord-002410-2zi5iv2t	151	9	be	be	VB
cord-002410-2zi5iv2t	151	10	present	present	JJ
cord-002410-2zi5iv2t	151	11	in	in	IN
cord-002410-2zi5iv2t	151	12	extracellular	extracellular	JJ
cord-002410-2zi5iv2t	151	13	,	,	,
cord-002410-2zi5iv2t	151	14	ER	ER	NNP
cord-002410-2zi5iv2t	151	15	,	,	,
cord-002410-2zi5iv2t	151	16	or	or	CC
cord-002410-2zi5iv2t	151	17	endosomal	endosomal	NNP
cord-002410-2zi5iv2t	151	18	compartments	compartment	NNS
cord-002410-2zi5iv2t	151	19	.	.	.
cord-002410-2zi5iv2t	152	1	Extracellular	Extracellular	NNP
cord-002410-2zi5iv2t	152	2	dsRNA	dsrna	NN
cord-002410-2zi5iv2t	152	3	,	,	,
cord-002410-2zi5iv2t	152	4	maybe	maybe	RB
cord-002410-2zi5iv2t	152	5	released	release	VBN
cord-002410-2zi5iv2t	152	6	from	from	IN
cord-002410-2zi5iv2t	152	7	dying	die	VBG
cord-002410-2zi5iv2t	152	8	cells	cell	NNS
cord-002410-2zi5iv2t	152	9	,	,	,
cord-002410-2zi5iv2t	152	10	can	can	MD
cord-002410-2zi5iv2t	152	11	be	be	VB
cord-002410-2zi5iv2t	152	12	taken	take	VBN
cord-002410-2zi5iv2t	152	13	up	up	RP
cord-002410-2zi5iv2t	152	14	into	into	IN
cord-002410-2zi5iv2t	152	15	uninfected	uninfected	JJ
cord-002410-2zi5iv2t	152	16	neighboring	neighboring	NN
cord-002410-2zi5iv2t	152	17	cells	cell	NNS
cord-002410-2zi5iv2t	152	18	by	by	IN
cord-002410-2zi5iv2t	152	19	class	class	NN
cord-002410-2zi5iv2t	152	20	A	a	DT
cord-002410-2zi5iv2t	152	21	scavenger	scavenger	NN
cord-002410-2zi5iv2t	152	22	receptors	receptor	NNS
cord-002410-2zi5iv2t	152	23	[	[	-LRB-
cord-002410-2zi5iv2t	152	24	77	77	CD
cord-002410-2zi5iv2t	152	25	]	]	-RRB-
cord-002410-2zi5iv2t	152	26	.	.	.
cord-002410-2zi5iv2t	153	1	After	after	IN
cord-002410-2zi5iv2t	153	2	endocytosis	endocytosis	NN
cord-002410-2zi5iv2t	153	3	,	,	,
cord-002410-2zi5iv2t	153	4	dsRNA	dsrna	NN
cord-002410-2zi5iv2t	153	5	is	be	VBZ
cord-002410-2zi5iv2t	153	6	brought	bring	VBN
cord-002410-2zi5iv2t	153	7	to	to	IN
cord-002410-2zi5iv2t	153	8	the	the	DT
cord-002410-2zi5iv2t	153	9	endosome	endosome	NN
cord-002410-2zi5iv2t	153	10	,	,	,
cord-002410-2zi5iv2t	153	11	where	where	WRB
cord-002410-2zi5iv2t	153	12	it	-PRON-	PRP
cord-002410-2zi5iv2t	153	13	is	be	VBZ
cord-002410-2zi5iv2t	153	14	bound	bind	VBN
cord-002410-2zi5iv2t	153	15	by	by	IN
cord-002410-2zi5iv2t	153	16	Toll	toll	NN
cord-002410-2zi5iv2t	153	17	-	-	HYPH
cord-002410-2zi5iv2t	153	18	like	like	JJ
cord-002410-2zi5iv2t	153	19	receptor	receptor	NN
cord-002410-2zi5iv2t	153	20	3	3	CD
cord-002410-2zi5iv2t	153	21	(	(	-LRB-
cord-002410-2zi5iv2t	153	22	TLR3	TLR3	NNP
cord-002410-2zi5iv2t	153	23	)	)	-RRB-
cord-002410-2zi5iv2t	153	24	.	.	.
cord-002410-2zi5iv2t	154	1	Alternatively	alternatively	RB
cord-002410-2zi5iv2t	154	2	,	,	,
cord-002410-2zi5iv2t	154	3	TLR3	TLR3	NNP
cord-002410-2zi5iv2t	154	4	might	may	MD
cord-002410-2zi5iv2t	154	5	engage	engage	VB
cord-002410-2zi5iv2t	154	6	HCV	HCV	NNP
cord-002410-2zi5iv2t	154	7	in	in	IN
cord-002410-2zi5iv2t	154	8	autophagic	autophagic	JJ
cord-002410-2zi5iv2t	154	9	vesicles	vesicle	NNS
cord-002410-2zi5iv2t	154	10	,	,	,
cord-002410-2zi5iv2t	154	11	as	as	IN
cord-002410-2zi5iv2t	154	12	HCV	HCV	NNP
cord-002410-2zi5iv2t	154	13	replicating	replicate	VBG
cord-002410-2zi5iv2t	154	14	cells	cell	NNS
cord-002410-2zi5iv2t	154	15	display	display	VBP
cord-002410-2zi5iv2t	154	16	an	an	DT
cord-002410-2zi5iv2t	154	17	enhanced	enhanced	JJ
cord-002410-2zi5iv2t	154	18	amount	amount	NN
cord-002410-2zi5iv2t	154	19	of	of	IN
cord-002410-2zi5iv2t	154	20	them	-PRON-	PRP
cord-002410-2zi5iv2t	154	21	[	[	-LRB-
cord-002410-2zi5iv2t	154	22	78	78	CD
cord-002410-2zi5iv2t	154	23	]	]	-RRB-
cord-002410-2zi5iv2t	154	24	.	.	.
cord-002410-2zi5iv2t	155	1	Recognition	recognition	NN
cord-002410-2zi5iv2t	155	2	of	of	IN
cord-002410-2zi5iv2t	155	3	dsRNA	dsrna	NN
cord-002410-2zi5iv2t	155	4	by	by	IN
cord-002410-2zi5iv2t	155	5	TLR3	TLR3	NNP
cord-002410-2zi5iv2t	155	6	activates	activate	VBZ
cord-002410-2zi5iv2t	155	7	TIR	TIR	NNP
cord-002410-2zi5iv2t	155	8	domain	domain	NN
cord-002410-2zi5iv2t	155	9	-	-	HYPH
cord-002410-2zi5iv2t	155	10	containing	contain	VBG
cord-002410-2zi5iv2t	155	11	adapter	adapter	NN
cord-002410-2zi5iv2t	155	12	-	-	HYPH
cord-002410-2zi5iv2t	155	13	inducing	induce	VBG
cord-002410-2zi5iv2t	155	14	IFN-(TRIF	ifn-(trif	NN
cord-002410-2zi5iv2t	155	15	;	;	:
cord-002410-2zi5iv2t	155	16	also	also	RB
cord-002410-2zi5iv2t	155	17	called	call	VBN
cord-002410-2zi5iv2t	155	18	TICAM-1	TICAM-1	NNP
cord-002410-2zi5iv2t	155	19	)	)	-RRB-
cord-002410-2zi5iv2t	155	20	signaling	signaling	NN
cord-002410-2zi5iv2t	155	21	.	.	.
cord-002410-2zi5iv2t	156	1	MAVS	MAVS	NNP
cord-002410-2zi5iv2t	156	2	and	and	CC
cord-002410-2zi5iv2t	156	3	TRIF	TRIF	NNP
cord-002410-2zi5iv2t	156	4	then	then	RB
cord-002410-2zi5iv2t	156	5	trigger	trigger	NN
cord-002410-2zi5iv2t	156	6	signaling	signal	VBG
cord-002410-2zi5iv2t	156	7	cascades	cascade	NNS
cord-002410-2zi5iv2t	156	8	leading	lead	VBG
cord-002410-2zi5iv2t	156	9	to	to	IN
cord-002410-2zi5iv2t	156	10	the	the	DT
cord-002410-2zi5iv2t	156	11	activation	activation	NN
cord-002410-2zi5iv2t	156	12	of	of	IN
cord-002410-2zi5iv2t	156	13	different	different	JJ
cord-002410-2zi5iv2t	156	14	cytosolic	cytosolic	JJ
cord-002410-2zi5iv2t	156	15	kinases	kinase	NNS
cord-002410-2zi5iv2t	156	16	(	(	-LRB-
cord-002410-2zi5iv2t	156	17	I	i	NN
cord-002410-2zi5iv2t	156	18	B	b	NN
cord-002410-2zi5iv2t	156	19	kinases	kinase	NNS
cord-002410-2zi5iv2t	156	20	(	(	-LRB-
cord-002410-2zi5iv2t	156	21	IKK	IKK	NNP
cord-002410-2zi5iv2t	156	22	)	)	-RRB-
cord-002410-2zi5iv2t	156	23	and	and	CC
cord-002410-2zi5iv2t	156	24	TANK	tank	NN
cord-002410-2zi5iv2t	156	25	-	-	HYPH
cord-002410-2zi5iv2t	156	26	binding	bind	VBG
cord-002410-2zi5iv2t	156	27	kinase	kinase	NN
cord-002410-2zi5iv2t	156	28	1	1	CD
cord-002410-2zi5iv2t	156	29	(	(	-LRB-
cord-002410-2zi5iv2t	156	30	TBK1	TBK1	NNP
cord-002410-2zi5iv2t	156	31	)	)	-RRB-
cord-002410-2zi5iv2t	156	32	)	)	-RRB-
cord-002410-2zi5iv2t	156	33	,	,	,
cord-002410-2zi5iv2t	156	34	which	which	WDT
cord-002410-2zi5iv2t	156	35	in	in	IN
cord-002410-2zi5iv2t	156	36	turn	turn	NN
cord-002410-2zi5iv2t	156	37	induce	induce	VBP
cord-002410-2zi5iv2t	156	38	activation	activation	NN
cord-002410-2zi5iv2t	156	39	of	of	IN
cord-002410-2zi5iv2t	156	40	the	the	DT
cord-002410-2zi5iv2t	156	41	key	key	JJ
cord-002410-2zi5iv2t	156	42	transcription	transcription	NN
cord-002410-2zi5iv2t	156	43	factors	factor	NNS
cord-002410-2zi5iv2t	156	44	NF	nf	NN
cord-002410-2zi5iv2t	156	45	-	-	HYPH
cord-002410-2zi5iv2t	156	46	B	B	NNP
cord-002410-2zi5iv2t	156	47	and	and	CC
cord-002410-2zi5iv2t	156	48	IRF3	IRF3	NNP
cord-002410-2zi5iv2t	156	49	[	[	-LRB-
cord-002410-2zi5iv2t	156	50	79	79	CD
cord-002410-2zi5iv2t	156	51	,	,	,
cord-002410-2zi5iv2t	156	52	80	80	CD
cord-002410-2zi5iv2t	156	53	]	]	-RRB-
cord-002410-2zi5iv2t	156	54	.	.	.
cord-002410-2zi5iv2t	157	1	Upon	upon	IN
cord-002410-2zi5iv2t	157	2	activation	activation	NN
cord-002410-2zi5iv2t	157	3	,	,	,
cord-002410-2zi5iv2t	157	4	these	these	DT
cord-002410-2zi5iv2t	157	5	proteins	protein	NNS
cord-002410-2zi5iv2t	157	6	translocate	translocate	VBP
cord-002410-2zi5iv2t	157	7	to	to	IN
cord-002410-2zi5iv2t	157	8	the	the	DT
cord-002410-2zi5iv2t	157	9	nucleus	nucleus	NN
cord-002410-2zi5iv2t	157	10	where	where	WRB
cord-002410-2zi5iv2t	157	11	they	-PRON-	PRP
cord-002410-2zi5iv2t	157	12	bind	bind	VBP
cord-002410-2zi5iv2t	157	13	to	to	IN
cord-002410-2zi5iv2t	157	14	promoter	promoter	NN
cord-002410-2zi5iv2t	157	15	elements	element	NNS
cord-002410-2zi5iv2t	157	16	in	in	IN
cord-002410-2zi5iv2t	157	17	type	type	NN
cord-002410-2zi5iv2t	157	18	I	-PRON-	PRP
cord-002410-2zi5iv2t	157	19	and	and	CC
cord-002410-2zi5iv2t	157	20	type	type	NN
cord-002410-2zi5iv2t	157	21	III	III	NNP
cord-002410-2zi5iv2t	157	22	IFN	IFN	NNP
cord-002410-2zi5iv2t	157	23	genes	gene	NNS
cord-002410-2zi5iv2t	157	24	.	.	.
cord-002410-2zi5iv2t	158	1	By	by	IN
cord-002410-2zi5iv2t	158	2	this	this	DT
cord-002410-2zi5iv2t	158	3	,	,	,
cord-002410-2zi5iv2t	158	4	inflammatory	inflammatory	JJ
cord-002410-2zi5iv2t	158	5	cytokine	cytokine	NN
cord-002410-2zi5iv2t	158	6	and	and	CC
cord-002410-2zi5iv2t	158	7	IFN	IFN	NNP
cord-002410-2zi5iv2t	158	8	expression	expression	NN
cord-002410-2zi5iv2t	158	9	is	be	VBZ
cord-002410-2zi5iv2t	158	10	initiated	initiate	VBN
cord-002410-2zi5iv2t	158	11	.	.	.
cord-002410-2zi5iv2t	159	1	Binding	bind	VBG
cord-002410-2zi5iv2t	159	2	of	of	IN
cord-002410-2zi5iv2t	159	3	secreted	secrete	VBN
cord-002410-2zi5iv2t	159	4	IFNs	ifn	NNS
cord-002410-2zi5iv2t	159	5	to	to	IN
cord-002410-2zi5iv2t	159	6	their	-PRON-	PRP$
cord-002410-2zi5iv2t	159	7	receptors	receptor	NNS
cord-002410-2zi5iv2t	159	8	in	in	IN
cord-002410-2zi5iv2t	159	9	an	an	DT
cord-002410-2zi5iv2t	159	10	autocrine	autocrine	JJ
cord-002410-2zi5iv2t	159	11	or	or	CC
cord-002410-2zi5iv2t	159	12	paracrine	paracrine	JJ
cord-002410-2zi5iv2t	159	13	manner	manner	NN
cord-002410-2zi5iv2t	159	14	leads	lead	VBZ
cord-002410-2zi5iv2t	159	15	to	to	IN
cord-002410-2zi5iv2t	159	16	the	the	DT
cord-002410-2zi5iv2t	159	17	activation	activation	NN
cord-002410-2zi5iv2t	159	18	of	of	IN
cord-002410-2zi5iv2t	159	19	the	the	DT
cord-002410-2zi5iv2t	159	20	JAK	JAK	NNP
cord-002410-2zi5iv2t	159	21	/	/	SYM
cord-002410-2zi5iv2t	159	22	STAT	stat	NN
cord-002410-2zi5iv2t	159	23	pathway	pathway	NN
cord-002410-2zi5iv2t	159	24	,	,	,
cord-002410-2zi5iv2t	159	25	as	as	IN
cord-002410-2zi5iv2t	159	26	depicted	depict	VBN
cord-002410-2zi5iv2t	159	27	in	in	IN
cord-002410-2zi5iv2t	159	28	Figure	Figure	NNP
cord-002410-2zi5iv2t	159	29	3	3	CD
cord-002410-2zi5iv2t	159	30	.	.	.
cord-002410-2zi5iv2t	160	1	Ultimately	ultimately	RB
cord-002410-2zi5iv2t	160	2	,	,	,
cord-002410-2zi5iv2t	160	3	this	this	DT
cord-002410-2zi5iv2t	160	4	triggers	trigger	VBZ
cord-002410-2zi5iv2t	160	5	the	the	DT
cord-002410-2zi5iv2t	160	6	expression	expression	NN
cord-002410-2zi5iv2t	160	7	of	of	IN
cord-002410-2zi5iv2t	160	8	hundreds	hundred	NNS
cord-002410-2zi5iv2t	160	9	of	of	IN
cord-002410-2zi5iv2t	160	10	IFN	IFN	NNP
cord-002410-2zi5iv2t	160	11	-	-	HYPH
cord-002410-2zi5iv2t	160	12	stimulated	stimulate	VBN
cord-002410-2zi5iv2t	160	13	genes	gene	NNS
cord-002410-2zi5iv2t	160	14	ISGs	isg	NNS
cord-002410-2zi5iv2t	160	15	,	,	,
cord-002410-2zi5iv2t	160	16	which	which	WDT
cord-002410-2zi5iv2t	160	17	generate	generate	VBP
cord-002410-2zi5iv2t	160	18	an	an	DT
cord-002410-2zi5iv2t	160	19	antiviral	antiviral	JJ
cord-002410-2zi5iv2t	160	20	state	state	NN
cord-002410-2zi5iv2t	160	21	limiting	limit	VBG
cord-002410-2zi5iv2t	160	22	HCV	HCV	NNP
cord-002410-2zi5iv2t	160	23	replication	replication	NN
cord-002410-2zi5iv2t	160	24	.	.	.
cord-002410-2zi5iv2t	161	1	During	during	IN
cord-002410-2zi5iv2t	161	2	CHC	CHC	NNP
cord-002410-2zi5iv2t	161	3	,	,	,
cord-002410-2zi5iv2t	161	4	the	the	DT
cord-002410-2zi5iv2t	161	5	innate	innate	JJ
cord-002410-2zi5iv2t	161	6	immune	immune	JJ
cord-002410-2zi5iv2t	161	7	response	response	NN
cord-002410-2zi5iv2t	161	8	can	can	MD
cord-002410-2zi5iv2t	161	9	only	only	RB
cord-002410-2zi5iv2t	161	10	control	control	VB
cord-002410-2zi5iv2t	161	11	HCV	HCV	NNP
cord-002410-2zi5iv2t	161	12	replication	replication	NN
cord-002410-2zi5iv2t	161	13	but	but	CC
cord-002410-2zi5iv2t	161	14	not	not	RB
cord-002410-2zi5iv2t	161	15	completely	completely	RB
cord-002410-2zi5iv2t	161	16	eliminate	eliminate	VB
cord-002410-2zi5iv2t	161	17	the	the	DT
cord-002410-2zi5iv2t	161	18	virus	virus	NN
cord-002410-2zi5iv2t	161	19	.	.	.
cord-002410-2zi5iv2t	162	1	This	this	DT
cord-002410-2zi5iv2t	162	2	is	be	VBZ
cord-002410-2zi5iv2t	162	3	partially	partially	RB
cord-002410-2zi5iv2t	162	4	due	due	JJ
cord-002410-2zi5iv2t	162	5	to	to	IN
cord-002410-2zi5iv2t	162	6	viral	viral	JJ
cord-002410-2zi5iv2t	162	7	mechanisms	mechanism	NNS
cord-002410-2zi5iv2t	162	8	counteracting	counteract	VBG
cord-002410-2zi5iv2t	162	9	the	the	DT
cord-002410-2zi5iv2t	162	10	immune	immune	JJ
cord-002410-2zi5iv2t	162	11	response	response	NN
cord-002410-2zi5iv2t	162	12	:	:	:
cord-002410-2zi5iv2t	162	13	Briefly	briefly	NN
cord-002410-2zi5iv2t	162	14	,	,	,
cord-002410-2zi5iv2t	162	15	HCV	HCV	NNP
cord-002410-2zi5iv2t	162	16	NS3/4A	ns3/4a	NN
cord-002410-2zi5iv2t	162	17	serine	serine	NN
cord-002410-2zi5iv2t	162	18	protease	protease	NN
cord-002410-2zi5iv2t	162	19	has	have	VBZ
cord-002410-2zi5iv2t	162	20	been	be	VBN
cord-002410-2zi5iv2t	162	21	shown	show	VBN
cord-002410-2zi5iv2t	162	22	to	to	TO
cord-002410-2zi5iv2t	162	23	inhibit	inhibit	VB
cord-002410-2zi5iv2t	162	24	IFR3	IFR3	NNP
cord-002410-2zi5iv2t	162	25	phosphorylation	phosphorylation	NN
cord-002410-2zi5iv2t	162	26	[	[	-LRB-
cord-002410-2zi5iv2t	162	27	81	81	CD
cord-002410-2zi5iv2t	162	28	]	]	-RRB-
cord-002410-2zi5iv2t	162	29	by	by	IN
cord-002410-2zi5iv2t	162	30	cleaving	cleave	VBG
cord-002410-2zi5iv2t	162	31	and	and	CC
cord-002410-2zi5iv2t	162	32	inactivating	inactivate	VBG
cord-002410-2zi5iv2t	162	33	the	the	DT
cord-002410-2zi5iv2t	162	34	RIG	rig	NN
cord-002410-2zi5iv2t	162	35	-	-	:
cord-002410-2zi5iv2t	162	36	I	i	NN
cord-002410-2zi5iv2t	162	37	adaptor	adaptor	NN
cord-002410-2zi5iv2t	162	38	protein	protein	NN
cord-002410-2zi5iv2t	162	39	MAVS	MAVS	NNP
cord-002410-2zi5iv2t	162	40	[	[	-LRB-
cord-002410-2zi5iv2t	162	41	82	82	CD
cord-002410-2zi5iv2t	162	42	]	]	-RRB-
cord-002410-2zi5iv2t	162	43	[	[	-LRB-
cord-002410-2zi5iv2t	162	44	83	83	CD
cord-002410-2zi5iv2t	162	45	]	]	-RRB-
cord-002410-2zi5iv2t	162	46	[	[	-LRB-
cord-002410-2zi5iv2t	162	47	84	84	CD
cord-002410-2zi5iv2t	162	48	]	]	-RRB-
cord-002410-2zi5iv2t	162	49	and	and	CC
cord-002410-2zi5iv2t	162	50	the	the	DT
cord-002410-2zi5iv2t	162	51	TLR3	TLR3	NNP
cord-002410-2zi5iv2t	162	52	adaptor	adaptor	NN
cord-002410-2zi5iv2t	162	53	protein	protein	NN
cord-002410-2zi5iv2t	163	1	TRIF	TRIF	NNP
cord-002410-2zi5iv2t	163	2	[	[	-LRB-
cord-002410-2zi5iv2t	163	3	85	85	CD
cord-002410-2zi5iv2t	163	4	]	]	-RRB-
cord-002410-2zi5iv2t	163	5	.	.	.
cord-002410-2zi5iv2t	164	1	Interestingly	interestingly	RB
cord-002410-2zi5iv2t	164	2	,	,	,
cord-002410-2zi5iv2t	164	3	recently	recently	RB
cord-002410-2zi5iv2t	164	4	discovered	discover	VBD
cord-002410-2zi5iv2t	164	5	members	member	NNS
cord-002410-2zi5iv2t	164	6	of	of	IN
cord-002410-2zi5iv2t	164	7	the	the	DT
cord-002410-2zi5iv2t	164	8	genus	genus	NN
cord-002410-2zi5iv2t	164	9	Hepacivirus	Hepacivirus	NNP
cord-002410-2zi5iv2t	164	10	infecting	infect	VBG
cord-002410-2zi5iv2t	164	11	nonhuman	nonhuman	NN
cord-002410-2zi5iv2t	164	12	mammals	mammal	NNS
cord-002410-2zi5iv2t	164	13	carry	carry	VBP
cord-002410-2zi5iv2t	164	14	an	an	DT
cord-002410-2zi5iv2t	164	15	NS3/4A	ns3/4a	JJ
cord-002410-2zi5iv2t	164	16	enzyme	enzyme	NN
cord-002410-2zi5iv2t	164	17	capable	capable	JJ
cord-002410-2zi5iv2t	164	18	of	of	IN
cord-002410-2zi5iv2t	164	19	cleaving	cleave	VBG
cord-002410-2zi5iv2t	164	20	not	not	RB
cord-002410-2zi5iv2t	164	21	only	only	RB
cord-002410-2zi5iv2t	164	22	their	-PRON-	PRP$
cord-002410-2zi5iv2t	164	23	cognate	cognate	JJ
cord-002410-2zi5iv2t	164	24	host	host	NN
cord-002410-2zi5iv2t	164	25	's	's	POS
cord-002410-2zi5iv2t	164	26	MAVS	MAVS	NNPS
cord-002410-2zi5iv2t	164	27	,	,	,
cord-002410-2zi5iv2t	164	28	but	but	CC
cord-002410-2zi5iv2t	164	29	also	also	RB
cord-002410-2zi5iv2t	164	30	human	human	JJ
cord-002410-2zi5iv2t	164	31	MAVS	MAVS	NNPS
cord-002410-2zi5iv2t	164	32	[	[	-LRB-
cord-002410-2zi5iv2t	164	33	86	86	CD
cord-002410-2zi5iv2t	164	34	]	]	-RRB-
cord-002410-2zi5iv2t	164	35	.	.	.
cord-002410-2zi5iv2t	165	1	This	this	DT
cord-002410-2zi5iv2t	165	2	suggests	suggest	VBZ
cord-002410-2zi5iv2t	165	3	that	that	IN
cord-002410-2zi5iv2t	165	4	all	all	DT
cord-002410-2zi5iv2t	165	5	yet	yet	RB
cord-002410-2zi5iv2t	165	6	studied	study	VBN
cord-002410-2zi5iv2t	165	7	hepaciviruses	hepaciviruse	NNS
cord-002410-2zi5iv2t	165	8	can	can	MD
cord-002410-2zi5iv2t	165	9	antagonize	antagonize	VB
cord-002410-2zi5iv2t	165	10	the	the	DT
cord-002410-2zi5iv2t	165	11	human	human	JJ
cord-002410-2zi5iv2t	165	12	antiviral	antiviral	JJ
cord-002410-2zi5iv2t	165	13	innate	innate	JJ
cord-002410-2zi5iv2t	165	14	immune	immune	JJ
cord-002410-2zi5iv2t	165	15	response	response	NN
cord-002410-2zi5iv2t	165	16	and	and	CC
cord-002410-2zi5iv2t	165	17	that	that	IN
cord-002410-2zi5iv2t	165	18	there	there	EX
cord-002410-2zi5iv2t	165	19	is	be	VBZ
cord-002410-2zi5iv2t	165	20	no	no	DT
cord-002410-2zi5iv2t	165	21	barrier	barrier	NN
cord-002410-2zi5iv2t	165	22	to	to	IN
cord-002410-2zi5iv2t	165	23	zoonotic	zoonotic	JJ
cord-002410-2zi5iv2t	165	24	transmission	transmission	NN
cord-002410-2zi5iv2t	165	25	at	at	IN
cord-002410-2zi5iv2t	165	26	the	the	DT
cord-002410-2zi5iv2t	165	27	level	level	NN
cord-002410-2zi5iv2t	165	28	of	of	IN
cord-002410-2zi5iv2t	165	29	innate	innate	JJ
cord-002410-2zi5iv2t	165	30	immune	immune	JJ
cord-002410-2zi5iv2t	165	31	interference	interference	NN
cord-002410-2zi5iv2t	165	32	.	.	.
cord-002410-2zi5iv2t	166	1	Humans	human	NNS
cord-002410-2zi5iv2t	166	2	chronically	chronically	RB
cord-002410-2zi5iv2t	166	3	infected	infect	VBN
cord-002410-2zi5iv2t	166	4	with	with	IN
cord-002410-2zi5iv2t	166	5	HCV	HCV	NNP
cord-002410-2zi5iv2t	166	6	display	display	NN
cord-002410-2zi5iv2t	166	7	increased	increase	VBD
cord-002410-2zi5iv2t	166	8	IFNL	IFNL	NNP
cord-002410-2zi5iv2t	166	9	expression	expression	NN
cord-002410-2zi5iv2t	166	10	.	.	.
cord-002410-2zi5iv2t	167	1	Specifically	specifically	RB
cord-002410-2zi5iv2t	167	2	,	,	,
cord-002410-2zi5iv2t	167	3	Dolganiuc	Dolganiuc	NNP
cord-002410-2zi5iv2t	167	4	et	et	FW
cord-002410-2zi5iv2t	167	5	al	al	NNP
cord-002410-2zi5iv2t	167	6	.	.	.
cord-002410-2zi5iv2t	168	1	showed	show	VBD
cord-002410-2zi5iv2t	168	2	that	that	IN
cord-002410-2zi5iv2t	168	3	IFNL	IFNL	NNP
cord-002410-2zi5iv2t	168	4	serum	serum	NN
cord-002410-2zi5iv2t	168	5	levels	level	NNS
cord-002410-2zi5iv2t	168	6	are	be	VBP
cord-002410-2zi5iv2t	168	7	higher	high	JJR
cord-002410-2zi5iv2t	168	8	in	in	IN
cord-002410-2zi5iv2t	168	9	CHC	CHC	NNP
cord-002410-2zi5iv2t	168	10	patients	patient	NNS
cord-002410-2zi5iv2t	168	11	than	than	IN
cord-002410-2zi5iv2t	168	12	in	in	IN
cord-002410-2zi5iv2t	168	13	HCV	HCV	NNP
cord-002410-2zi5iv2t	168	14	-	-	HYPH
cord-002410-2zi5iv2t	168	15	negative	negative	JJ
cord-002410-2zi5iv2t	168	16	with	with	IN
cord-002410-2zi5iv2t	168	17	liver	liver	NN
cord-002410-2zi5iv2t	168	18	inflammation	inflammation	NN
cord-002410-2zi5iv2t	168	19	[	[	-LRB-
cord-002410-2zi5iv2t	168	20	87	87	CD
cord-002410-2zi5iv2t	168	21	]	]	-RRB-
cord-002410-2zi5iv2t	168	22	.	.	.
cord-002410-2zi5iv2t	169	1	The	the	DT
cord-002410-2zi5iv2t	169	2	authors	author	NNS
cord-002410-2zi5iv2t	169	3	observed	observe	VBD
cord-002410-2zi5iv2t	169	4	elevated	elevated	JJ
cord-002410-2zi5iv2t	169	5	expression	expression	NN
cord-002410-2zi5iv2t	169	6	of	of	IN
cord-002410-2zi5iv2t	169	7	the	the	DT
cord-002410-2zi5iv2t	169	8	IFNLR	IFNLR	NNP
cord-002410-2zi5iv2t	169	9	in	in	IN
cord-002410-2zi5iv2t	169	10	liver	liver	NN
cord-002410-2zi5iv2t	169	11	biopsies	biopsy	NNS
cord-002410-2zi5iv2t	169	12	from	from	IN
cord-002410-2zi5iv2t	169	13	CHC	CHC	NNP
cord-002410-2zi5iv2t	169	14	patients	patient	NNS
cord-002410-2zi5iv2t	169	15	.	.	.
cord-002410-2zi5iv2t	170	1	Studying	study	VBG
cord-002410-2zi5iv2t	170	2	liver	liver	NN
cord-002410-2zi5iv2t	170	3	biopsies	biopsy	NNS
cord-002410-2zi5iv2t	170	4	from	from	IN
cord-002410-2zi5iv2t	170	5	infected	infected	JJ
cord-002410-2zi5iv2t	170	6	patients	patient	NNS
cord-002410-2zi5iv2t	170	7	also	also	RB
cord-002410-2zi5iv2t	170	8	helped	help	VBD
cord-002410-2zi5iv2t	170	9	to	to	TO
cord-002410-2zi5iv2t	170	10	confirm	confirm	VB
cord-002410-2zi5iv2t	170	11	that	that	IN
cord-002410-2zi5iv2t	170	12	there	there	EX
cord-002410-2zi5iv2t	170	13	is	be	VBZ
cord-002410-2zi5iv2t	170	14	an	an	DT
cord-002410-2zi5iv2t	170	15	association	association	NN
cord-002410-2zi5iv2t	170	16	between	between	IN
cord-002410-2zi5iv2t	170	17	IFNL	IFNL	NNP
cord-002410-2zi5iv2t	170	18	and	and	CC
cord-002410-2zi5iv2t	170	19	ISG	ISG	NNP
cord-002410-2zi5iv2t	170	20	expression	expression	NN
cord-002410-2zi5iv2t	170	21	levels	level	NNS
cord-002410-2zi5iv2t	170	22	;	;	:
cord-002410-2zi5iv2t	170	23	namely	namely	RB
cord-002410-2zi5iv2t	170	24	,	,	,
cord-002410-2zi5iv2t	170	25	that	that	IN
cord-002410-2zi5iv2t	170	26	IFNL	IFNL	NNP
cord-002410-2zi5iv2t	170	27	expression	expression	NN
cord-002410-2zi5iv2t	170	28	leads	lead	VBZ
cord-002410-2zi5iv2t	170	29	to	to	IN
cord-002410-2zi5iv2t	170	30	elevated	elevated	VB
cord-002410-2zi5iv2t	170	31	ISG	ISG	NNP
cord-002410-2zi5iv2t	170	32	induction	induction	NN
cord-002410-2zi5iv2t	170	33	[	[	-LRB-
cord-002410-2zi5iv2t	170	34	88	88	CD
cord-002410-2zi5iv2t	170	35	,	,	,
cord-002410-2zi5iv2t	170	36	89	89	CD
cord-002410-2zi5iv2t	170	37	]	]	-RRB-
cord-002410-2zi5iv2t	170	38	.	.	.
cord-002410-2zi5iv2t	171	1	In	in	IN
cord-002410-2zi5iv2t	171	2	particular	particular	JJ
cord-002410-2zi5iv2t	171	3	,	,	,
cord-002410-2zi5iv2t	171	4	a	a	DT
cord-002410-2zi5iv2t	171	5	correlation	correlation	NN
cord-002410-2zi5iv2t	171	6	between	between	IN
cord-002410-2zi5iv2t	171	7	the	the	DT
cord-002410-2zi5iv2t	171	8	activity	activity	NN
cord-002410-2zi5iv2t	171	9	of	of	IN
cord-002410-2zi5iv2t	171	10	the	the	DT
cord-002410-2zi5iv2t	171	11	IFNL4	ifnl4	NN
cord-002410-2zi5iv2t	171	12	protein	protein	NN
cord-002410-2zi5iv2t	171	13	and	and	CC
cord-002410-2zi5iv2t	171	14	ISG	ISG	NNP
cord-002410-2zi5iv2t	171	15	induction	induction	NN
cord-002410-2zi5iv2t	171	16	has	have	VBZ
cord-002410-2zi5iv2t	171	17	been	be	VBN
cord-002410-2zi5iv2t	171	18	discovered	discover	VBN
cord-002410-2zi5iv2t	171	19	.	.	.
cord-002410-2zi5iv2t	172	1	Surprisingly	surprisingly	RB
cord-002410-2zi5iv2t	172	2	,	,	,
cord-002410-2zi5iv2t	172	3	high	high	JJ
cord-002410-2zi5iv2t	172	4	IFNL4	ifnl4	NN
cord-002410-2zi5iv2t	172	5	and	and	CC
cord-002410-2zi5iv2t	172	6	ISG	ISG	NNP
cord-002410-2zi5iv2t	172	7	levels	level	NNS
cord-002410-2zi5iv2t	172	8	negatively	negatively	RB
cord-002410-2zi5iv2t	172	9	impacted	impact	VBD
cord-002410-2zi5iv2t	172	10	the	the	DT
cord-002410-2zi5iv2t	172	11	outcome	outcome	NN
cord-002410-2zi5iv2t	172	12	of	of	IN
cord-002410-2zi5iv2t	172	13	HCV	HCV	NNP
cord-002410-2zi5iv2t	172	14	infection	infection	NN
cord-002410-2zi5iv2t	172	15	and	and	CC
cord-002410-2zi5iv2t	172	16	treatment	treatment	NN
cord-002410-2zi5iv2t	172	17	(	(	-LRB-
cord-002410-2zi5iv2t	172	18	see	see	VB
cord-002410-2zi5iv2t	172	19	Section	section	NN
cord-002410-2zi5iv2t	172	20	3.2	3.2	CD
cord-002410-2zi5iv2t	172	21	)	)	-RRB-
cord-002410-2zi5iv2t	172	22	[	[	-LRB-
cord-002410-2zi5iv2t	172	23	90	90	CD
cord-002410-2zi5iv2t	172	24	]	]	-RRB-
cord-002410-2zi5iv2t	172	25	.	.	.
cord-002410-2zi5iv2t	173	1	The	the	DT
cord-002410-2zi5iv2t	173	2	host	host	NN
cord-002410-2zi5iv2t	173	3	immune	immune	JJ
cord-002410-2zi5iv2t	173	4	response	response	NN
cord-002410-2zi5iv2t	173	5	to	to	IN
cord-002410-2zi5iv2t	173	6	acute	acute	JJ
cord-002410-2zi5iv2t	173	7	HCV	HCV	NNP
cord-002410-2zi5iv2t	173	8	infection	infection	NN
cord-002410-2zi5iv2t	173	9	has	have	VBZ
cord-002410-2zi5iv2t	173	10	been	be	VBN
cord-002410-2zi5iv2t	173	11	studied	study	VBN
cord-002410-2zi5iv2t	173	12	in	in	IN
cord-002410-2zi5iv2t	173	13	experimentally	experimentally	RB
cord-002410-2zi5iv2t	173	14	infected	infect	VBN
cord-002410-2zi5iv2t	173	15	chimpanzees	chimpanzee	NNS
cord-002410-2zi5iv2t	173	16	and	and	CC
cord-002410-2zi5iv2t	173	17	in	in	IN
cord-002410-2zi5iv2t	173	18	genetically	genetically	RB
cord-002410-2zi5iv2t	173	19	humanized	humanize	VBN
cord-002410-2zi5iv2t	173	20	mice	mouse	NNS
cord-002410-2zi5iv2t	173	21	.	.	.
cord-002410-2zi5iv2t	174	1	In	in	IN
cord-002410-2zi5iv2t	174	2	the	the	DT
cord-002410-2zi5iv2t	174	3	livers	liver	NNS
cord-002410-2zi5iv2t	174	4	of	of	IN
cord-002410-2zi5iv2t	174	5	chimpanzees	chimpanzee	NNS
cord-002410-2zi5iv2t	174	6	a	a	DT
cord-002410-2zi5iv2t	174	7	strong	strong	JJ
cord-002410-2zi5iv2t	174	8	host	host	NN
cord-002410-2zi5iv2t	174	9	response	response	NN
cord-002410-2zi5iv2t	174	10	can	can	MD
cord-002410-2zi5iv2t	174	11	be	be	VB
cord-002410-2zi5iv2t	174	12	detected	detect	VBN
cord-002410-2zi5iv2t	174	13	,	,	,
cord-002410-2zi5iv2t	174	14	including	include	VBG
cord-002410-2zi5iv2t	174	15	the	the	DT
cord-002410-2zi5iv2t	174	16	induction	induction	NN
cord-002410-2zi5iv2t	174	17	of	of	IN
cord-002410-2zi5iv2t	174	18	type	type	NN
cord-002410-2zi5iv2t	174	19	III	III	NNP
cord-002410-2zi5iv2t	174	20	IFN	IFN	NNP
cord-002410-2zi5iv2t	174	21	transcription	transcription	NN
cord-002410-2zi5iv2t	174	22	and	and	CC
cord-002410-2zi5iv2t	174	23	ISG	ISG	NNP
cord-002410-2zi5iv2t	174	24	expression	expression	NN
cord-002410-2zi5iv2t	174	25	[	[	-LRB-
cord-002410-2zi5iv2t	174	26	88	88	CD
cord-002410-2zi5iv2t	174	27	,	,	,
cord-002410-2zi5iv2t	174	28	91	91	CD
cord-002410-2zi5iv2t	174	29	]	]	-RRB-
cord-002410-2zi5iv2t	174	30	.	.	.
cord-002410-2zi5iv2t	175	1	Especially	especially	RB
cord-002410-2zi5iv2t	175	2	IFNL1	ifnl1	NN
cord-002410-2zi5iv2t	176	1	mRNA	mRNA	NNP
cord-002410-2zi5iv2t	176	2	and	and	CC
cord-002410-2zi5iv2t	176	3	protein	protein	NN
cord-002410-2zi5iv2t	176	4	levels	level	NNS
cord-002410-2zi5iv2t	176	5	are	be	VBP
cord-002410-2zi5iv2t	176	6	elevated	elevate	VBN
cord-002410-2zi5iv2t	176	7	,	,	,
cord-002410-2zi5iv2t	176	8	correlating	correlate	VBG
cord-002410-2zi5iv2t	176	9	with	with	IN
cord-002410-2zi5iv2t	176	10	ISG	ISG	NNP
cord-002410-2zi5iv2t	176	11	expression	expression	NN
cord-002410-2zi5iv2t	176	12	and	and	CC
cord-002410-2zi5iv2t	176	13	viremia	viremia	NN
cord-002410-2zi5iv2t	176	14	.	.	.
cord-002410-2zi5iv2t	177	1	However	however	RB
cord-002410-2zi5iv2t	177	2	,	,	,
cord-002410-2zi5iv2t	177	3	there	there	EX
cord-002410-2zi5iv2t	177	4	is	be	VBZ
cord-002410-2zi5iv2t	177	5	no	no	DT
cord-002410-2zi5iv2t	177	6	link	link	NN
cord-002410-2zi5iv2t	177	7	between	between	IN
cord-002410-2zi5iv2t	177	8	type	type	NN
cord-002410-2zi5iv2t	177	9	III	III	NNP
cord-002410-2zi5iv2t	177	10	IFN	IFN	NNP
cord-002410-2zi5iv2t	177	11	expression	expression	NN
cord-002410-2zi5iv2t	177	12	in	in	IN
cord-002410-2zi5iv2t	177	13	the	the	DT
cord-002410-2zi5iv2t	177	14	liver	liver	NN
cord-002410-2zi5iv2t	177	15	or	or	CC
cord-002410-2zi5iv2t	177	16	peripheral	peripheral	JJ
cord-002410-2zi5iv2t	177	17	organs	organ	NNS
cord-002410-2zi5iv2t	177	18	of	of	IN
cord-002410-2zi5iv2t	177	19	infected	infected	JJ
cord-002410-2zi5iv2t	177	20	chimpanzees	chimpanzee	NNS
cord-002410-2zi5iv2t	177	21	and	and	CC
cord-002410-2zi5iv2t	177	22	the	the	DT
cord-002410-2zi5iv2t	177	23	outcome	outcome	NN
cord-002410-2zi5iv2t	177	24	of	of	IN
cord-002410-2zi5iv2t	177	25	the	the	DT
cord-002410-2zi5iv2t	177	26	acute	acute	JJ
cord-002410-2zi5iv2t	177	27	infection	infection	NN
cord-002410-2zi5iv2t	177	28	[	[	-LRB-
cord-002410-2zi5iv2t	177	29	91	91	CD
cord-002410-2zi5iv2t	177	30	]	]	-RRB-
cord-002410-2zi5iv2t	177	31	.	.	.
cord-002410-2zi5iv2t	178	1	Consistently	consistently	RB
cord-002410-2zi5iv2t	178	2	,	,	,
cord-002410-2zi5iv2t	178	3	in	in	IN
cord-002410-2zi5iv2t	178	4	immunocompetent	immunocompetent	JJ
cord-002410-2zi5iv2t	178	5	transgenic	transgenic	JJ
cord-002410-2zi5iv2t	178	6	mice	mouse	NNS
cord-002410-2zi5iv2t	178	7	expressing	express	VBG
cord-002410-2zi5iv2t	178	8	the	the	DT
cord-002410-2zi5iv2t	178	9	human	human	JJ
cord-002410-2zi5iv2t	178	10	HCV	HCV	NNP
cord-002410-2zi5iv2t	178	11	entry	entry	NN
cord-002410-2zi5iv2t	178	12	factors	factor	NNS
cord-002410-2zi5iv2t	178	13	,	,	,
cord-002410-2zi5iv2t	178	14	HCV	HCV	NNP
cord-002410-2zi5iv2t	178	15	infection	infection	NN
cord-002410-2zi5iv2t	178	16	results	result	VBZ
cord-002410-2zi5iv2t	178	17	in	in	IN
cord-002410-2zi5iv2t	178	18	upregulation	upregulation	NN
cord-002410-2zi5iv2t	178	19	of	of	IN
cord-002410-2zi5iv2t	178	20	several	several	JJ
cord-002410-2zi5iv2t	178	21	ISGs	isg	NNS
cord-002410-2zi5iv2t	178	22	[	[	-LRB-
cord-002410-2zi5iv2t	178	23	92	92	CD
cord-002410-2zi5iv2t	178	24	]	]	-RRB-
cord-002410-2zi5iv2t	178	25	.	.	.
cord-002410-2zi5iv2t	179	1	This	this	DT
cord-002410-2zi5iv2t	179	2	is	be	VBZ
cord-002410-2zi5iv2t	179	3	consistent	consistent	JJ
cord-002410-2zi5iv2t	179	4	with	with	IN
cord-002410-2zi5iv2t	179	5	the	the	DT
cord-002410-2zi5iv2t	179	6	observation	observation	NN
cord-002410-2zi5iv2t	179	7	that	that	IN
cord-002410-2zi5iv2t	179	8	mouse	mouse	NN
cord-002410-2zi5iv2t	179	9	-	-	HYPH
cord-002410-2zi5iv2t	179	10	liver	liver	NN
cord-002410-2zi5iv2t	179	11	derived	derive	VBN
cord-002410-2zi5iv2t	179	12	cells	cell	NNS
cord-002410-2zi5iv2t	179	13	produce	produce	VBP
cord-002410-2zi5iv2t	179	14	type	type	NN
cord-002410-2zi5iv2t	179	15	I	-PRON-	PRP
cord-002410-2zi5iv2t	179	16	and	and	CC
cord-002410-2zi5iv2t	179	17	III	III	NNP
cord-002410-2zi5iv2t	179	18	IFNs	ifn	NNS
cord-002410-2zi5iv2t	179	19	when	when	WRB
cord-002410-2zi5iv2t	179	20	transfected	transfecte	VBN
cord-002410-2zi5iv2t	179	21	with	with	IN
cord-002410-2zi5iv2t	179	22	HCV	HCV	NNP
cord-002410-2zi5iv2t	179	23	subgenomic	subgenomic	NNP
cord-002410-2zi5iv2t	179	24	RNA	RNA	NNP
cord-002410-2zi5iv2t	179	25	and	and	CC
cord-002410-2zi5iv2t	179	26	this	this	DT
cord-002410-2zi5iv2t	179	27	leads	lead	VBZ
cord-002410-2zi5iv2t	179	28	to	to	IN
cord-002410-2zi5iv2t	179	29	abrogation	abrogation	NN
cord-002410-2zi5iv2t	179	30	of	of	IN
cord-002410-2zi5iv2t	179	31	HCV	HCV	NNP
cord-002410-2zi5iv2t	179	32	replication	replication	NN
cord-002410-2zi5iv2t	179	33	[	[	-LRB-
cord-002410-2zi5iv2t	179	34	93	93	CD
cord-002410-2zi5iv2t	179	35	]	]	-RRB-
cord-002410-2zi5iv2t	179	36	.	.	.
cord-002410-2zi5iv2t	180	1	Of	of	IN
cord-002410-2zi5iv2t	180	2	note	note	VB
cord-002410-2zi5iv2t	180	3	,	,	,
cord-002410-2zi5iv2t	180	4	current	current	JJ
cord-002410-2zi5iv2t	180	5	mouse	mouse	NN
cord-002410-2zi5iv2t	180	6	models	model	NNS
cord-002410-2zi5iv2t	180	7	do	do	VBP
cord-002410-2zi5iv2t	180	8	not	not	RB
cord-002410-2zi5iv2t	180	9	allow	allow	VB
cord-002410-2zi5iv2t	180	10	chronic	chronic	JJ
cord-002410-2zi5iv2t	180	11	HCV	HCV	NNP
cord-002410-2zi5iv2t	180	12	infection	infection	NN
cord-002410-2zi5iv2t	180	13	and	and	CC
cord-002410-2zi5iv2t	180	14	since	since	IN
cord-002410-2zi5iv2t	180	15	the	the	DT
cord-002410-2zi5iv2t	180	16	ban	ban	NN
cord-002410-2zi5iv2t	180	17	on	on	IN
cord-002410-2zi5iv2t	180	18	chimpanzee	chimpanzee	NN
cord-002410-2zi5iv2t	180	19	experimentation	experimentation	NN
cord-002410-2zi5iv2t	180	20	there	there	EX
cord-002410-2zi5iv2t	180	21	are	be	VBP
cord-002410-2zi5iv2t	180	22	no	no	DT
cord-002410-2zi5iv2t	180	23	immunocompetent	immunocompetent	JJ
cord-002410-2zi5iv2t	180	24	animal	animal	NN
cord-002410-2zi5iv2t	180	25	models	model	NNS
cord-002410-2zi5iv2t	180	26	to	to	TO
cord-002410-2zi5iv2t	180	27	study	study	VB
cord-002410-2zi5iv2t	180	28	CHC	CHC	NNP
cord-002410-2zi5iv2t	180	29	.	.	.
cord-002410-2zi5iv2t	181	1	Recent	recent	JJ
cord-002410-2zi5iv2t	181	2	efforts	effort	NNS
cord-002410-2zi5iv2t	181	3	on	on	IN
cord-002410-2zi5iv2t	181	4	establishing	establish	VBG
cord-002410-2zi5iv2t	181	5	alternative	alternative	JJ
cord-002410-2zi5iv2t	181	6	nonhuman	nonhuman	NN
cord-002410-2zi5iv2t	181	7	primate	primate	NN
cord-002410-2zi5iv2t	181	8	models	model	NNS
cord-002410-2zi5iv2t	181	9	for	for	IN
cord-002410-2zi5iv2t	181	10	hepatitis	hepatitis	NN
cord-002410-2zi5iv2t	181	11	C	C	NNP
cord-002410-2zi5iv2t	181	12	[	[	-LRB-
cord-002410-2zi5iv2t	181	13	94	94	CD
cord-002410-2zi5iv2t	181	14	,	,	,
cord-002410-2zi5iv2t	181	15	95	95	CD
cord-002410-2zi5iv2t	181	16	]	]	-RRB-
cord-002410-2zi5iv2t	181	17	and	and	CC
cord-002410-2zi5iv2t	181	18	on	on	IN
cord-002410-2zi5iv2t	181	19	using	use	VBG
cord-002410-2zi5iv2t	181	20	rodent	rodent	NN
cord-002410-2zi5iv2t	181	21	hepaciviruses	hepaciviruse	NNS
cord-002410-2zi5iv2t	181	22	as	as	IN
cord-002410-2zi5iv2t	181	23	surrogate	surrogate	JJ
cord-002410-2zi5iv2t	181	24	infectious	infectious	JJ
cord-002410-2zi5iv2t	181	25	agents	agent	NNS
cord-002410-2zi5iv2t	181	26	to	to	TO
cord-002410-2zi5iv2t	181	27	study	study	VB
cord-002410-2zi5iv2t	181	28	CHC	CHC	NNP
cord-002410-2zi5iv2t	181	29	,	,	,
cord-002410-2zi5iv2t	181	30	might	may	MD
cord-002410-2zi5iv2t	181	31	resolve	resolve	VB
cord-002410-2zi5iv2t	181	32	this	this	DT
cord-002410-2zi5iv2t	181	33	hurdle	hurdle	NN
cord-002410-2zi5iv2t	181	34	in	in	IN
cord-002410-2zi5iv2t	181	35	the	the	DT
cord-002410-2zi5iv2t	181	36	future	future	NN
cord-002410-2zi5iv2t	181	37	[	[	-LRB-
cord-002410-2zi5iv2t	181	38	96	96	CD
cord-002410-2zi5iv2t	181	39	,	,	,
cord-002410-2zi5iv2t	181	40	97	97	CD
cord-002410-2zi5iv2t	181	41	]	]	-RRB-
cord-002410-2zi5iv2t	181	42	.	.	.
cord-002410-2zi5iv2t	182	1	hepatocytes	hepatocyte	NNS
cord-002410-2zi5iv2t	182	2	[	[	-LRB-
cord-002410-2zi5iv2t	182	3	88	88	CD
cord-002410-2zi5iv2t	182	4	,	,	,
cord-002410-2zi5iv2t	182	5	91	91	CD
cord-002410-2zi5iv2t	182	6	]	]	-RRB-
cord-002410-2zi5iv2t	182	7	.	.	.
cord-002410-2zi5iv2t	183	1	Type	Type	NNP
cord-002410-2zi5iv2t	183	2	III	III	NNP
cord-002410-2zi5iv2t	183	3	IFNs	ifn	NNS
cord-002410-2zi5iv2t	183	4	and	and	CC
cord-002410-2zi5iv2t	183	5	ISGs	isg	NNS
cord-002410-2zi5iv2t	183	6	are	be	VBP
cord-002410-2zi5iv2t	183	7	similarly	similarly	RB
cord-002410-2zi5iv2t	183	8	inducted	induct	VBN
cord-002410-2zi5iv2t	183	9	upon	upon	IN
cord-002410-2zi5iv2t	183	10	HCV	HCV	NNP
cord-002410-2zi5iv2t	183	11	infection	infection	NN
cord-002410-2zi5iv2t	183	12	of	of	IN
cord-002410-2zi5iv2t	183	13	primary	primary	JJ
cord-002410-2zi5iv2t	183	14	human	human	JJ
cord-002410-2zi5iv2t	183	15	fetal	fetal	JJ
cord-002410-2zi5iv2t	183	16	liver	liver	NN
cord-002410-2zi5iv2t	183	17	cells	cell	NNS
cord-002410-2zi5iv2t	183	18	[	[	-LRB-
cord-002410-2zi5iv2t	183	19	98	98	CD
cord-002410-2zi5iv2t	183	20	,	,	,
cord-002410-2zi5iv2t	183	21	99	99	CD
cord-002410-2zi5iv2t	183	22	]	]	-RRB-
cord-002410-2zi5iv2t	183	23	.	.	.
cord-002410-2zi5iv2t	184	1	Here	here	RB
cord-002410-2zi5iv2t	184	2	the	the	DT
cord-002410-2zi5iv2t	184	3	magnitude	magnitude	NN
cord-002410-2zi5iv2t	184	4	of	of	IN
cord-002410-2zi5iv2t	184	5	induction	induction	NN
cord-002410-2zi5iv2t	184	6	differs	differ	VBZ
cord-002410-2zi5iv2t	184	7	from	from	IN
cord-002410-2zi5iv2t	184	8	donor	donor	NN
cord-002410-2zi5iv2t	184	9	to	to	IN
cord-002410-2zi5iv2t	184	10	donor	donor	NN
cord-002410-2zi5iv2t	184	11	but	but	CC
cord-002410-2zi5iv2t	184	12	correlates	correlate	VBZ
cord-002410-2zi5iv2t	184	13	with	with	IN
cord-002410-2zi5iv2t	184	14	virus	virus	NN
cord-002410-2zi5iv2t	184	15	replication	replication	NN
cord-002410-2zi5iv2t	184	16	.	.	.
cord-002410-2zi5iv2t	185	1	To	to	TO
cord-002410-2zi5iv2t	185	2	study	study	VB
cord-002410-2zi5iv2t	185	3	different	different	JJ
cord-002410-2zi5iv2t	185	4	aspects	aspect	NNS
cord-002410-2zi5iv2t	185	5	of	of	IN
cord-002410-2zi5iv2t	185	6	the	the	DT
cord-002410-2zi5iv2t	185	7	HCV	HCV	NNP
cord-002410-2zi5iv2t	185	8	life	life	NN
cord-002410-2zi5iv2t	185	9	cycle	cycle	NN
cord-002410-2zi5iv2t	185	10	,	,	,
cord-002410-2zi5iv2t	185	11	hepatoma	hepatoma	NNP
cord-002410-2zi5iv2t	185	12	cell	cell	NN
cord-002410-2zi5iv2t	185	13	lines	line	NNS
cord-002410-2zi5iv2t	185	14	are	be	VBP
cord-002410-2zi5iv2t	185	15	frequently	frequently	RB
cord-002410-2zi5iv2t	185	16	used	use	VBN
cord-002410-2zi5iv2t	185	17	.	.	.
cord-002410-2zi5iv2t	186	1	Similar	similar	JJ
cord-002410-2zi5iv2t	186	2	to	to	IN
cord-002410-2zi5iv2t	186	3	HCV	HCV	NNP
cord-002410-2zi5iv2t	186	4	infection	infection	NN
cord-002410-2zi5iv2t	186	5	of	of	IN
cord-002410-2zi5iv2t	186	6	primary	primary	JJ
cord-002410-2zi5iv2t	186	7	cells	cell	NNS
cord-002410-2zi5iv2t	186	8	,	,	,
cord-002410-2zi5iv2t	186	9	also	also	RB
cord-002410-2zi5iv2t	186	10	the	the	DT
cord-002410-2zi5iv2t	186	11	hepatoma	hepatoma	NNP
cord-002410-2zi5iv2t	186	12	cell	cell	NN
cord-002410-2zi5iv2t	186	13	line	line	NN
cord-002410-2zi5iv2t	186	14	HepG2	HepG2	NNP
cord-002410-2zi5iv2t	186	15	induces	induce	VBZ
cord-002410-2zi5iv2t	186	16	IFNL	IFNL	NNP
cord-002410-2zi5iv2t	186	17	transcription	transcription	NN
cord-002410-2zi5iv2t	186	18	upon	upon	IN
cord-002410-2zi5iv2t	186	19	infection	infection	NN
cord-002410-2zi5iv2t	186	20	[	[	-LRB-
cord-002410-2zi5iv2t	186	21	74	74	CD
cord-002410-2zi5iv2t	186	22	,	,	,
cord-002410-2zi5iv2t	186	23	88	88	CD
cord-002410-2zi5iv2t	186	24	]	]	-RRB-
cord-002410-2zi5iv2t	186	25	.	.	.
cord-002410-2zi5iv2t	187	1	Interestingly	interestingly	RB
cord-002410-2zi5iv2t	187	2	,	,	,
cord-002410-2zi5iv2t	187	3	Israelow	Israelow	NNP
cord-002410-2zi5iv2t	187	4	et	et	NNP
cord-002410-2zi5iv2t	187	5	al	al	NNP
cord-002410-2zi5iv2t	187	6	.	.	NNP
cord-002410-2zi5iv2t	187	7	showed	show	VBD
cord-002410-2zi5iv2t	187	8	that	that	IN
cord-002410-2zi5iv2t	187	9	IFNL	IFNL	NNP
cord-002410-2zi5iv2t	187	10	induction	induction	NN
cord-002410-2zi5iv2t	187	11	attenuates	attenuate	VBZ
cord-002410-2zi5iv2t	187	12	HCV	HCV	NNP
cord-002410-2zi5iv2t	187	13	replication	replication	NN
cord-002410-2zi5iv2t	187	14	and	and	CC
cord-002410-2zi5iv2t	187	15	that	that	IN
cord-002410-2zi5iv2t	187	16	the	the	DT
cord-002410-2zi5iv2t	187	17	IFNL	IFNL	NNP
cord-002410-2zi5iv2t	187	18	response	response	NN
cord-002410-2zi5iv2t	187	19	in	in	IN
cord-002410-2zi5iv2t	187	20	HepG2-HFL	HepG2-HFL	NNP
cord-002410-2zi5iv2t	187	21	cells	cell	NNS
cord-002410-2zi5iv2t	187	22	stably	stably	RB
cord-002410-2zi5iv2t	187	23	replicating	replicate	VBG
cord-002410-2zi5iv2t	187	24	a	a	DT
cord-002410-2zi5iv2t	187	25	HCV	HCV	NNP
cord-002410-2zi5iv2t	187	26	subgenome	subgenome	NN
cord-002410-2zi5iv2t	187	27	is	be	VBZ
cord-002410-2zi5iv2t	187	28	blunted	blunt	VBN
cord-002410-2zi5iv2t	187	29	,	,	,
cord-002410-2zi5iv2t	187	30	probably	probably	RB
cord-002410-2zi5iv2t	187	31	due	due	JJ
cord-002410-2zi5iv2t	187	32	to	to	IN
cord-002410-2zi5iv2t	187	33	MAVS	MAVS	NNP
cord-002410-2zi5iv2t	187	34	cleavage	cleavage	NN
cord-002410-2zi5iv2t	187	35	by	by	IN
cord-002410-2zi5iv2t	187	36	HCV	HCV	NNP
cord-002410-2zi5iv2t	187	37	NS3/4A	NS3/4A	NNP
cord-002410-2zi5iv2t	187	38	[	[	-LRB-
cord-002410-2zi5iv2t	187	39	100	100	CD
cord-002410-2zi5iv2t	187	40	]	]	-RRB-
cord-002410-2zi5iv2t	187	41	.	.	.
cord-002410-2zi5iv2t	188	1	With	with	IN
cord-002410-2zi5iv2t	188	2	regard	regard	NN
cord-002410-2zi5iv2t	188	3	to	to	IN
cord-002410-2zi5iv2t	188	4	IFNL4	IFNL4	NNP
cord-002410-2zi5iv2t	188	5	,	,	,
cord-002410-2zi5iv2t	188	6	Hong	Hong	NNP
cord-002410-2zi5iv2t	188	7	et	et	NNP
cord-002410-2zi5iv2t	188	8	al	al	NNP
cord-002410-2zi5iv2t	188	9	.	.	.
cord-002410-2zi5iv2t	189	1	found	find	VBD
cord-002410-2zi5iv2t	189	2	that	that	IN
cord-002410-2zi5iv2t	189	3	endogenous	endogenous	JJ
cord-002410-2zi5iv2t	189	4	IFNL4	ifnl4	NN
cord-002410-2zi5iv2t	189	5	transcription	transcription	NN
cord-002410-2zi5iv2t	189	6	is	be	VBZ
cord-002410-2zi5iv2t	189	7	only	only	RB
cord-002410-2zi5iv2t	189	8	poorly	poorly	RB
cord-002410-2zi5iv2t	189	9	induced	induce	VBN
cord-002410-2zi5iv2t	189	10	upon	upon	IN
cord-002410-2zi5iv2t	189	11	stimulation	stimulation	NN
cord-002410-2zi5iv2t	189	12	with	with	IN
cord-002410-2zi5iv2t	189	13	HCV	HCV	NNP
cord-002410-2zi5iv2t	189	14	in	in	IN
cord-002410-2zi5iv2t	189	15	different	different	JJ
cord-002410-2zi5iv2t	189	16	hepatoma	hepatoma	NNP
cord-002410-2zi5iv2t	189	17	cell	cell	NN
cord-002410-2zi5iv2t	189	18	lines	line	NNS
cord-002410-2zi5iv2t	189	19	and	and	CC
cord-002410-2zi5iv2t	189	20	PHH	PHH	NNP
cord-002410-2zi5iv2t	189	21	.	.	.
cord-002410-2zi5iv2t	190	1	Also	also	RB
cord-002410-2zi5iv2t	190	2	no	no	DT
cord-002410-2zi5iv2t	190	3	or	or	CC
cord-002410-2zi5iv2t	190	4	reduced	reduced	JJ
cord-002410-2zi5iv2t	190	5	levels	level	NNS
cord-002410-2zi5iv2t	190	6	of	of	IN
cord-002410-2zi5iv2t	190	7	secreted	secrete	VBN
cord-002410-2zi5iv2t	190	8	IFNL4	ifnl4	RB
cord-002410-2zi5iv2t	190	9	as	as	IN
cord-002410-2zi5iv2t	190	10	compared	compare	VBN
cord-002410-2zi5iv2t	190	11	to	to	IN
cord-002410-2zi5iv2t	190	12	IFNL3	IFNL3	NNS
cord-002410-2zi5iv2t	190	13	are	be	VBP
cord-002410-2zi5iv2t	190	14	detectable	detectable	JJ
cord-002410-2zi5iv2t	190	15	upon	upon	IN
cord-002410-2zi5iv2t	190	16	HCV	HCV	NNP
cord-002410-2zi5iv2t	190	17	infection	infection	NN
cord-002410-2zi5iv2t	190	18	[	[	-LRB-
cord-002410-2zi5iv2t	190	19	3	3	CD
cord-002410-2zi5iv2t	190	20	]	]	-RRB-
cord-002410-2zi5iv2t	190	21	.	.	.
cord-002410-2zi5iv2t	191	1	The	the	DT
cord-002410-2zi5iv2t	191	2	partial	partial	JJ
cord-002410-2zi5iv2t	191	3	retention	retention	NN
cord-002410-2zi5iv2t	191	4	of	of	IN
cord-002410-2zi5iv2t	191	5	IFNL4	ifnl4	NN
cord-002410-2zi5iv2t	191	6	in	in	IN
cord-002410-2zi5iv2t	191	7	the	the	DT
cord-002410-2zi5iv2t	191	8	cytoplasm	cytoplasm	NN
cord-002410-2zi5iv2t	191	9	,	,	,
cord-002410-2zi5iv2t	191	10	as	as	IN
cord-002410-2zi5iv2t	191	11	observed	observe	VBN
cord-002410-2zi5iv2t	191	12	in	in	IN
cord-002410-2zi5iv2t	191	13	HepG2	HepG2	NNP
cord-002410-2zi5iv2t	191	14	cells	cell	NNS
cord-002410-2zi5iv2t	191	15	and	and	CC
cord-002410-2zi5iv2t	191	16	PHH	PHH	NNP
cord-002410-2zi5iv2t	191	17	in	in	IN
cord-002410-2zi5iv2t	191	18	a	a	DT
cord-002410-2zi5iv2t	191	19	different	different	JJ
cord-002410-2zi5iv2t	191	20	study	study	NN
cord-002410-2zi5iv2t	191	21	,	,	,
cord-002410-2zi5iv2t	191	22	might	may	MD
cord-002410-2zi5iv2t	191	23	explain	explain	VB
cord-002410-2zi5iv2t	191	24	this	this	DT
cord-002410-2zi5iv2t	191	25	observation	observation	NN
cord-002410-2zi5iv2t	191	26	[	[	-LRB-
cord-002410-2zi5iv2t	191	27	101	101	CD
cord-002410-2zi5iv2t	191	28	]	]	-RRB-
cord-002410-2zi5iv2t	191	29	.	.	.
cord-002410-2zi5iv2t	192	1	The	the	DT
cord-002410-2zi5iv2t	192	2	clear	clear	JJ
cord-002410-2zi5iv2t	192	3	correlation	correlation	NN
cord-002410-2zi5iv2t	192	4	between	between	IN
cord-002410-2zi5iv2t	192	5	IFNL	IFNL	NNP
cord-002410-2zi5iv2t	192	6	induction	induction	NN
cord-002410-2zi5iv2t	192	7	and	and	CC
cord-002410-2zi5iv2t	192	8	HCV	HCV	NNP
cord-002410-2zi5iv2t	192	9	attenuation	attenuation	NN
cord-002410-2zi5iv2t	192	10	observed	observe	VBN
cord-002410-2zi5iv2t	192	11	in	in	IN
cord-002410-2zi5iv2t	192	12	hepatoma	hepatoma	NNP
cord-002410-2zi5iv2t	192	13	cell	cell	NN
cord-002410-2zi5iv2t	192	14	lines	line	NNS
cord-002410-2zi5iv2t	192	15	does	do	VBZ
cord-002410-2zi5iv2t	192	16	not	not	RB
cord-002410-2zi5iv2t	192	17	reflect	reflect	VB
cord-002410-2zi5iv2t	192	18	observations	observation	NNS
cord-002410-2zi5iv2t	192	19	in	in	IN
cord-002410-2zi5iv2t	192	20	CHC	CHC	NNP
cord-002410-2zi5iv2t	192	21	patients	patient	NNS
cord-002410-2zi5iv2t	192	22	for	for	IN
cord-002410-2zi5iv2t	192	23	several	several	JJ
cord-002410-2zi5iv2t	192	24	reasons	reason	NNS
cord-002410-2zi5iv2t	192	25	.	.	.
cord-002410-2zi5iv2t	193	1	First	first	RB
cord-002410-2zi5iv2t	193	2	,	,	,
cord-002410-2zi5iv2t	193	3	the	the	DT
cord-002410-2zi5iv2t	193	4	complexity	complexity	NN
cord-002410-2zi5iv2t	193	5	of	of	IN
cord-002410-2zi5iv2t	193	6	the	the	DT
cord-002410-2zi5iv2t	193	7	liver	liver	NN
cord-002410-2zi5iv2t	193	8	with	with	IN
cord-002410-2zi5iv2t	193	9	contributions	contribution	NNS
cord-002410-2zi5iv2t	193	10	of	of	IN
cord-002410-2zi5iv2t	193	11	Kupffer	Kupffer	NNP
cord-002410-2zi5iv2t	193	12	cells	cell	NNS
cord-002410-2zi5iv2t	193	13	,	,	,
cord-002410-2zi5iv2t	193	14	liver	liver	NN
cord-002410-2zi5iv2t	193	15	sinusoidal	sinusoidal	NN
cord-002410-2zi5iv2t	193	16	endothelial	endothelial	JJ
cord-002410-2zi5iv2t	193	17	cells	cell	NNS
cord-002410-2zi5iv2t	193	18	,	,	,
cord-002410-2zi5iv2t	193	19	stellate	stellate	JJ
cord-002410-2zi5iv2t	193	20	cells	cell	NNS
cord-002410-2zi5iv2t	193	21	,	,	,
cord-002410-2zi5iv2t	193	22	and	and	CC
cord-002410-2zi5iv2t	193	23	infiltrating	infiltrate	VBG
cord-002410-2zi5iv2t	193	24	additional	additional	JJ
cord-002410-2zi5iv2t	193	25	immune	immune	JJ
cord-002410-2zi5iv2t	193	26	cells	cell	NNS
cord-002410-2zi5iv2t	193	27	(	(	-LRB-
cord-002410-2zi5iv2t	193	28	reviewed	review	VBN
cord-002410-2zi5iv2t	193	29	in	in	IN
cord-002410-2zi5iv2t	193	30	[	[	-LRB-
cord-002410-2zi5iv2t	193	31	102	102	CD
cord-002410-2zi5iv2t	193	32	]	]	-RRB-
cord-002410-2zi5iv2t	193	33	)	)	-RRB-
cord-002410-2zi5iv2t	193	34	is	be	VBZ
cord-002410-2zi5iv2t	193	35	obviously	obviously	RB
cord-002410-2zi5iv2t	193	36	not	not	RB
cord-002410-2zi5iv2t	193	37	mimicked	mimic	VBN
cord-002410-2zi5iv2t	193	38	by	by	IN
cord-002410-2zi5iv2t	193	39	simple	simple	JJ
cord-002410-2zi5iv2t	193	40	cell	cell	NN
cord-002410-2zi5iv2t	193	41	culture	culture	NN
cord-002410-2zi5iv2t	193	42	models	model	NNS
cord-002410-2zi5iv2t	193	43	.	.	.
cord-002410-2zi5iv2t	194	1	Second	second	RB
cord-002410-2zi5iv2t	194	2	,	,	,
cord-002410-2zi5iv2t	194	3	transformed	transformed	JJ
cord-002410-2zi5iv2t	194	4	cell	cell	NN
cord-002410-2zi5iv2t	194	5	lines	line	NNS
cord-002410-2zi5iv2t	194	6	do	do	VBP
cord-002410-2zi5iv2t	194	7	not	not	RB
cord-002410-2zi5iv2t	194	8	necessarily	necessarily	RB
cord-002410-2zi5iv2t	194	9	resemble	resemble	VB
cord-002410-2zi5iv2t	194	10	primary	primary	JJ
cord-002410-2zi5iv2t	194	11	hepatocytes	hepatocyte	NNS
cord-002410-2zi5iv2t	194	12	.	.	.
cord-002410-2zi5iv2t	195	1	In	in	IN
cord-002410-2zi5iv2t	195	2	fact	fact	NN
cord-002410-2zi5iv2t	195	3	,	,	,
cord-002410-2zi5iv2t	195	4	most	most	JJS
cord-002410-2zi5iv2t	195	5	hepatoma	hepatoma	NNP
cord-002410-2zi5iv2t	195	6	cell	cell	NN
cord-002410-2zi5iv2t	195	7	lines	line	NNS
cord-002410-2zi5iv2t	195	8	that	that	WDT
cord-002410-2zi5iv2t	195	9	can	can	MD
cord-002410-2zi5iv2t	195	10	be	be	VB
cord-002410-2zi5iv2t	195	11	infected	infect	VBN
cord-002410-2zi5iv2t	195	12	with	with	IN
cord-002410-2zi5iv2t	195	13	HCV	HCV	NNP
cord-002410-2zi5iv2t	195	14	do	do	VBP
cord-002410-2zi5iv2t	195	15	not	not	RB
cord-002410-2zi5iv2t	195	16	mount	mount	VB
cord-002410-2zi5iv2t	195	17	a	a	DT
cord-002410-2zi5iv2t	195	18	strong	strong	JJ
cord-002410-2zi5iv2t	195	19	innate	innate	JJ
cord-002410-2zi5iv2t	195	20	immune	immune	JJ
cord-002410-2zi5iv2t	195	21	response	response	NN
cord-002410-2zi5iv2t	195	22	[	[	-LRB-
cord-002410-2zi5iv2t	195	23	73	73	CD
cord-002410-2zi5iv2t	195	24	]	]	-RRB-
cord-002410-2zi5iv2t	195	25	.	.	.
cord-002410-2zi5iv2t	196	1	Nevertheless	nevertheless	RB
cord-002410-2zi5iv2t	196	2	hepatoma	hepatoma	NNP
cord-002410-2zi5iv2t	196	3	cell	cell	NN
cord-002410-2zi5iv2t	196	4	lines	line	NNS
cord-002410-2zi5iv2t	196	5	are	be	VBP
cord-002410-2zi5iv2t	196	6	regularly	regularly	RB
cord-002410-2zi5iv2t	196	7	used	use	VBN
cord-002410-2zi5iv2t	196	8	to	to	TO
cord-002410-2zi5iv2t	196	9	study	study	VB
cord-002410-2zi5iv2t	196	10	the	the	DT
cord-002410-2zi5iv2t	196	11	effect	effect	NN
cord-002410-2zi5iv2t	196	12	of	of	IN
cord-002410-2zi5iv2t	196	13	exogenously	exogenously	RB
cord-002410-2zi5iv2t	196	14	added	add	VBN
cord-002410-2zi5iv2t	196	15	IFNL	IFNL	NNP
cord-002410-2zi5iv2t	196	16	on	on	IN
cord-002410-2zi5iv2t	196	17	HCV	HCV	NNP
cord-002410-2zi5iv2t	196	18	infection	infection	NN
cord-002410-2zi5iv2t	196	19	as	as	IN
cord-002410-2zi5iv2t	196	20	they	-PRON-	PRP
cord-002410-2zi5iv2t	196	21	typically	typically	RB
cord-002410-2zi5iv2t	196	22	express	express	VBP
cord-002410-2zi5iv2t	196	23	all	all	DT
cord-002410-2zi5iv2t	196	24	components	component	NNS
cord-002410-2zi5iv2t	196	25	of	of	IN
cord-002410-2zi5iv2t	196	26	the	the	DT
cord-002410-2zi5iv2t	196	27	IFNLR	IFNLR	NNP
cord-002410-2zi5iv2t	196	28	pathway	pathway	NN
cord-002410-2zi5iv2t	196	29	.	.	.
cord-002410-2zi5iv2t	197	1	IFNL	IFNL	NNP
cord-002410-2zi5iv2t	197	2	stimulation	stimulation	NN
cord-002410-2zi5iv2t	197	3	reduces	reduce	VBZ
cord-002410-2zi5iv2t	197	4	levels	level	NNS
cord-002410-2zi5iv2t	197	5	of	of	IN
cord-002410-2zi5iv2t	197	6	subgenomic	subgenomic	JJ
cord-002410-2zi5iv2t	197	7	or	or	CC
cord-002410-2zi5iv2t	197	8	full	full	JJ
cord-002410-2zi5iv2t	197	9	length	length	NN
cord-002410-2zi5iv2t	197	10	genomic	genomic	JJ
cord-002410-2zi5iv2t	197	11	HCV	HCV	NNP
cord-002410-2zi5iv2t	197	12	(	(	-LRB-
cord-002410-2zi5iv2t	197	13	+	+	CC
cord-002410-2zi5iv2t	197	14	)	)	-RRB-
cord-002410-2zi5iv2t	197	15	RNA	RNA	NNP
cord-002410-2zi5iv2t	197	16	in	in	IN
cord-002410-2zi5iv2t	197	17	Huh-7	Huh-7	NNP
cord-002410-2zi5iv2t	197	18	cells	cell	NNS
cord-002410-2zi5iv2t	197	19	in	in	IN
cord-002410-2zi5iv2t	197	20	a	a	DT
cord-002410-2zi5iv2t	197	21	dose	dose	NN
cord-002410-2zi5iv2t	197	22	dependentmanner	dependentmanner	NNPS
cord-002410-2zi5iv2t	197	23	[	[	-LRB-
cord-002410-2zi5iv2t	197	24	49	49	CD
cord-002410-2zi5iv2t	197	25	,	,	,
cord-002410-2zi5iv2t	197	26	103	103	CD
cord-002410-2zi5iv2t	197	27	,	,	,
cord-002410-2zi5iv2t	197	28	104	104	CD
cord-002410-2zi5iv2t	197	29	]	]	-RRB-
cord-002410-2zi5iv2t	197	30	.	.	.
cord-002410-2zi5iv2t	198	1	These	these	DT
cord-002410-2zi5iv2t	198	2	results	result	NNS
cord-002410-2zi5iv2t	198	3	were	be	VBD
cord-002410-2zi5iv2t	198	4	confirmed	confirm	VBN
cord-002410-2zi5iv2t	198	5	in	in	IN
cord-002410-2zi5iv2t	198	6	several	several	JJ
cord-002410-2zi5iv2t	198	7	other	other	JJ
cord-002410-2zi5iv2t	198	8	hepatoma	hepatoma	NNP
cord-002410-2zi5iv2t	198	9	cell	cell	NN
cord-002410-2zi5iv2t	198	10	lines	line	NNS
cord-002410-2zi5iv2t	198	11	,	,	,
cord-002410-2zi5iv2t	198	12	including	include	VBG
cord-002410-2zi5iv2t	198	13	the	the	DT
cord-002410-2zi5iv2t	198	14	Huh-7	Huh-7	NNP
cord-002410-2zi5iv2t	198	15	derived	derive	VBN
cord-002410-2zi5iv2t	198	16	Lunet	Lunet	NNP
cord-002410-2zi5iv2t	198	17	hCD81	hcd81	NN
cord-002410-2zi5iv2t	198	18	cells	cell	NNS
cord-002410-2zi5iv2t	198	19	expressing	express	VBG
cord-002410-2zi5iv2t	198	20	a	a	DT
cord-002410-2zi5iv2t	198	21	firefly	firefly	NN
cord-002410-2zi5iv2t	198	22	luciferase	luciferase	NN
cord-002410-2zi5iv2t	198	23	gene	gene	NN
cord-002410-2zi5iv2t	198	24	or	or	CC
cord-002410-2zi5iv2t	198	25	HepG2	HepG2	NNP
cord-002410-2zi5iv2t	198	26	cells	cell	NNS
cord-002410-2zi5iv2t	198	27	expressing	express	VBG
cord-002410-2zi5iv2t	198	28	microRNA122	microrna122	ADD
cord-002410-2zi5iv2t	198	29	and	and	CC
cord-002410-2zi5iv2t	198	30	CD81	CD81	NNP
cord-002410-2zi5iv2t	198	31	[	[	-LRB-
cord-002410-2zi5iv2t	198	32	3	3	CD
cord-002410-2zi5iv2t	198	33	]	]	-RRB-
cord-002410-2zi5iv2t	198	34	.	.	.
cord-002410-2zi5iv2t	199	1	Hepatoma	Hepatoma	NNP
cord-002410-2zi5iv2t	199	2	cell	cell	NN
cord-002410-2zi5iv2t	199	3	lines	line	NNS
cord-002410-2zi5iv2t	199	4	and	and	CC
cord-002410-2zi5iv2t	199	5	PHH	PHH	NNP
cord-002410-2zi5iv2t	199	6	have	have	VBP
cord-002410-2zi5iv2t	199	7	also	also	RB
cord-002410-2zi5iv2t	199	8	been	be	VBN
cord-002410-2zi5iv2t	199	9	used	use	VBN
cord-002410-2zi5iv2t	199	10	to	to	TO
cord-002410-2zi5iv2t	199	11	study	study	VB
cord-002410-2zi5iv2t	199	12	how	how	WRB
cord-002410-2zi5iv2t	199	13	the	the	DT
cord-002410-2zi5iv2t	199	14	IFNL	IFNL	NNP
cord-002410-2zi5iv2t	199	15	subtypes	subtype	NNS
cord-002410-2zi5iv2t	199	16	differ	differ	VBP
cord-002410-2zi5iv2t	199	17	in	in	IN
cord-002410-2zi5iv2t	199	18	their	-PRON-	PRP$
cord-002410-2zi5iv2t	199	19	ability	ability	NN
cord-002410-2zi5iv2t	199	20	to	to	TO
cord-002410-2zi5iv2t	199	21	limit	limit	VB
cord-002410-2zi5iv2t	199	22	viral	viral	JJ
cord-002410-2zi5iv2t	199	23	infections	infection	NNS
cord-002410-2zi5iv2t	199	24	;	;	:
cord-002410-2zi5iv2t	199	25	IFNL3	IFNL3	NNS
cord-002410-2zi5iv2t	199	26	and	and	CC
cord-002410-2zi5iv2t	199	27	IFNL4	IFNL4	NNP
cord-002410-2zi5iv2t	199	28	induce	induce	VB
cord-002410-2zi5iv2t	199	29	the	the	DT
cord-002410-2zi5iv2t	199	30	same	same	JJ
cord-002410-2zi5iv2t	199	31	set	set	NN
cord-002410-2zi5iv2t	199	32	of	of	IN
cord-002410-2zi5iv2t	199	33	ISGs	ISGs	NNPS
cord-002410-2zi5iv2t	199	34	in	in	IN
cord-002410-2zi5iv2t	199	35	PHH	PHH	NNP
cord-002410-2zi5iv2t	199	36	[	[	-LRB-
cord-002410-2zi5iv2t	199	37	105	105	CD
cord-002410-2zi5iv2t	199	38	]	]	-RRB-
cord-002410-2zi5iv2t	199	39	and	and	CC
cord-002410-2zi5iv2t	199	40	the	the	DT
cord-002410-2zi5iv2t	199	41	two	two	CD
cord-002410-2zi5iv2t	199	42	subtypes	subtype	NNS
cord-002410-2zi5iv2t	199	43	have	have	VBP
cord-002410-2zi5iv2t	199	44	the	the	DT
cord-002410-2zi5iv2t	199	45	same	same	JJ
cord-002410-2zi5iv2t	199	46	antiviral	antiviral	JJ
cord-002410-2zi5iv2t	199	47	activity	activity	NN
cord-002410-2zi5iv2t	199	48	against	against	IN
cord-002410-2zi5iv2t	199	49	HCV	HCV	NNP
cord-002410-2zi5iv2t	199	50	in	in	IN
cord-002410-2zi5iv2t	199	51	an	an	DT
cord-002410-2zi5iv2t	199	52	overexpression	overexpression	NN
cord-002410-2zi5iv2t	199	53	setup	setup	NN
cord-002410-2zi5iv2t	199	54	in	in	IN
cord-002410-2zi5iv2t	199	55	hepatoma	hepatoma	NNP
cord-002410-2zi5iv2t	199	56	cells	cell	NNS
cord-002410-2zi5iv2t	199	57	.	.	.
cord-002410-2zi5iv2t	200	1	In	in	IN
cord-002410-2zi5iv2t	200	2	summary	summary	NN
cord-002410-2zi5iv2t	200	3	,	,	,
cord-002410-2zi5iv2t	200	4	expression	expression	NN
cord-002410-2zi5iv2t	200	5	of	of	IN
cord-002410-2zi5iv2t	200	6	specific	specific	JJ
cord-002410-2zi5iv2t	200	7	IFNL	IFNL	NNP
cord-002410-2zi5iv2t	200	8	subtypes	subtype	NNS
cord-002410-2zi5iv2t	200	9	is	be	VBZ
cord-002410-2zi5iv2t	200	10	induced	induce	VBN
cord-002410-2zi5iv2t	200	11	in	in	IN
cord-002410-2zi5iv2t	200	12	PHH	PHH	NNP
cord-002410-2zi5iv2t	200	13	and	and	CC
cord-002410-2zi5iv2t	200	14	some	some	DT
cord-002410-2zi5iv2t	200	15	hepatoma	hepatoma	NNP
cord-002410-2zi5iv2t	200	16	cell	cell	NN
cord-002410-2zi5iv2t	200	17	lines	line	NNS
cord-002410-2zi5iv2t	200	18	upon	upon	IN
cord-002410-2zi5iv2t	200	19	infection	infection	NN
cord-002410-2zi5iv2t	200	20	with	with	IN
cord-002410-2zi5iv2t	200	21	HCV	HCV	NNP
cord-002410-2zi5iv2t	200	22	,	,	,
cord-002410-2zi5iv2t	200	23	resulting	result	VBG
cord-002410-2zi5iv2t	200	24	in	in	IN
cord-002410-2zi5iv2t	200	25	limiting	limit	VBG
cord-002410-2zi5iv2t	200	26	virus	virus	NN
cord-002410-2zi5iv2t	200	27	production	production	NN
cord-002410-2zi5iv2t	200	28	.	.	.
cord-002410-2zi5iv2t	201	1	However	however	RB
cord-002410-2zi5iv2t	201	2	,	,	,
cord-002410-2zi5iv2t	201	3	the	the	DT
cord-002410-2zi5iv2t	201	4	majority	majority	NN
cord-002410-2zi5iv2t	201	5	of	of	IN
cord-002410-2zi5iv2t	201	6	hepatoma	hepatoma	NNP
cord-002410-2zi5iv2t	201	7	cell	cell	NN
cord-002410-2zi5iv2t	201	8	lines	line	NNS
cord-002410-2zi5iv2t	201	9	do	do	VBP
cord-002410-2zi5iv2t	201	10	not	not	RB
cord-002410-2zi5iv2t	201	11	elicit	elicit	VB
cord-002410-2zi5iv2t	201	12	a	a	DT
cord-002410-2zi5iv2t	201	13	strong	strong	JJ
cord-002410-2zi5iv2t	201	14	immune	immune	JJ
cord-002410-2zi5iv2t	201	15	response	response	NN
cord-002410-2zi5iv2t	201	16	and	and	CC
cord-002410-2zi5iv2t	201	17	IFNL	IFNL	NNP
cord-002410-2zi5iv2t	201	18	expression	expression	NN
cord-002410-2zi5iv2t	201	19	.	.	.
cord-002410-2zi5iv2t	202	1	Novel	novel	JJ
cord-002410-2zi5iv2t	202	2	model	model	NN
cord-002410-2zi5iv2t	202	3	systems	system	NNS
cord-002410-2zi5iv2t	202	4	including	include	VBG
cord-002410-2zi5iv2t	202	5	stem	stem	NN
cord-002410-2zi5iv2t	202	6	cell	cell	NN
cord-002410-2zi5iv2t	202	7	derived	derive	VBN
cord-002410-2zi5iv2t	202	8	hepatocytes	hepatocyte	NNS
cord-002410-2zi5iv2t	202	9	[	[	-LRB-
cord-002410-2zi5iv2t	202	10	106	106	CD
cord-002410-2zi5iv2t	202	11	]	]	-RRB-
cord-002410-2zi5iv2t	202	12	[	[	-LRB-
cord-002410-2zi5iv2t	202	13	107	107	CD
cord-002410-2zi5iv2t	202	14	]	]	-RRB-
cord-002410-2zi5iv2t	203	1	[	[	-LRB-
cord-002410-2zi5iv2t	203	2	108	108	CD
cord-002410-2zi5iv2t	203	3	]	]	-RRB-
cord-002410-2zi5iv2t	203	4	and	and	CC
cord-002410-2zi5iv2t	203	5	tissue	tissue	NN
cord-002410-2zi5iv2t	203	6	engineering	engineering	NN
cord-002410-2zi5iv2t	203	7	systems	system	NNS
cord-002410-2zi5iv2t	203	8	[	[	-LRB-
cord-002410-2zi5iv2t	203	9	109	109	CD
cord-002410-2zi5iv2t	203	10	]	]	-RRB-
cord-002410-2zi5iv2t	203	11	might	may	MD
cord-002410-2zi5iv2t	203	12	in	in	IN
cord-002410-2zi5iv2t	203	13	the	the	DT
cord-002410-2zi5iv2t	203	14	future	future	NN
cord-002410-2zi5iv2t	203	15	allow	allow	VB
cord-002410-2zi5iv2t	203	16	to	to	IN
cord-002410-2zi5iv2t	203	17	more	more	RBR
cord-002410-2zi5iv2t	203	18	faithfully	faithfully	RB
cord-002410-2zi5iv2t	203	19	mimic	mimic	VB
cord-002410-2zi5iv2t	203	20	host	host	NN
cord-002410-2zi5iv2t	203	21	responses	response	NNS
cord-002410-2zi5iv2t	203	22	to	to	IN
cord-002410-2zi5iv2t	203	23	hepatotropic	hepatotropic	NNP
cord-002410-2zi5iv2t	203	24	virus	virus	NN
cord-002410-2zi5iv2t	203	25	infection	infection	NN
cord-002410-2zi5iv2t	203	26	.	.	.
cord-002410-2zi5iv2t	204	1	After	after	IN
cord-002410-2zi5iv2t	204	2	establishment	establishment	NN
cord-002410-2zi5iv2t	204	3	of	of	IN
cord-002410-2zi5iv2t	204	4	PEG	PEG	NNP
cord-002410-2zi5iv2t	204	5	-	-	HYPH
cord-002410-2zi5iv2t	204	6	IFN	IFN	NNP
cord-002410-2zi5iv2t	204	7	-	-	HYPH
cord-002410-2zi5iv2t	204	8	alpha	alpha	NN
cord-002410-2zi5iv2t	204	9	and	and	CC
cord-002410-2zi5iv2t	204	10	RBV	RBV	NNP
cord-002410-2zi5iv2t	204	11	as	as	IN
cord-002410-2zi5iv2t	204	12	the	the	DT
cord-002410-2zi5iv2t	204	13	standard	standard	NN
cord-002410-2zi5iv2t	204	14	of	of	IN
cord-002410-2zi5iv2t	204	15	care	care	NN
cord-002410-2zi5iv2t	204	16	treatment	treatment	NN
cord-002410-2zi5iv2t	204	17	for	for	IN
cord-002410-2zi5iv2t	204	18	hepatitis	hepatitis	NN
cord-002410-2zi5iv2t	204	19	C	C	NNP
cord-002410-2zi5iv2t	204	20	[	[	-LRB-
cord-002410-2zi5iv2t	204	21	110	110	CD
cord-002410-2zi5iv2t	204	22	]	]	-RRB-
cord-002410-2zi5iv2t	204	23	,	,	,
cord-002410-2zi5iv2t	204	24	it	-PRON-	PRP
cord-002410-2zi5iv2t	204	25	became	become	VBD
cord-002410-2zi5iv2t	204	26	clear	clear	JJ
cord-002410-2zi5iv2t	204	27	that	that	IN
cord-002410-2zi5iv2t	204	28	patients	patient	NNS
cord-002410-2zi5iv2t	204	29	of	of	IN
cord-002410-2zi5iv2t	204	30	African	african	JJ
cord-002410-2zi5iv2t	204	31	ancestry	ancestry	NN
cord-002410-2zi5iv2t	204	32	had	have	VBD
cord-002410-2zi5iv2t	204	33	significantly	significantly	RB
cord-002410-2zi5iv2t	204	34	lower	low	JJR
cord-002410-2zi5iv2t	204	35	cure	cure	NN
cord-002410-2zi5iv2t	204	36	rates	rate	NNS
cord-002410-2zi5iv2t	204	37	than	than	IN
cord-002410-2zi5iv2t	204	38	those	those	DT
cord-002410-2zi5iv2t	204	39	of	of	IN
cord-002410-2zi5iv2t	204	40	European	european	JJ
cord-002410-2zi5iv2t	204	41	ancestry	ancestry	NN
cord-002410-2zi5iv2t	204	42	during	during	IN
cord-002410-2zi5iv2t	204	43	IFN	IFN	NNP
cord-002410-2zi5iv2t	204	44	-	-	HYPH
cord-002410-2zi5iv2t	204	45	alpha	alpha	NNP
cord-002410-2zi5iv2t	204	46	/	/	SYM
cord-002410-2zi5iv2t	204	47	RBV	RBV	NNP
cord-002410-2zi5iv2t	204	48	treatment	treatment	NN
cord-002410-2zi5iv2t	204	49	.	.	.
cord-002410-2zi5iv2t	205	1	In	in	IN
cord-002410-2zi5iv2t	205	2	2009	2009	CD
cord-002410-2zi5iv2t	205	3	,	,	,
cord-002410-2zi5iv2t	205	4	two	two	CD
cord-002410-2zi5iv2t	205	5	genome	genome	NN
cord-002410-2zi5iv2t	205	6	-	-	HYPH
cord-002410-2zi5iv2t	205	7	wide	wide	JJ
cord-002410-2zi5iv2t	205	8	association	association	NN
cord-002410-2zi5iv2t	205	9	studies	study	NNS
cord-002410-2zi5iv2t	205	10	discovered	discover	VBD
cord-002410-2zi5iv2t	205	11	IFNL	IFNL	NNP
cord-002410-2zi5iv2t	205	12	gene	gene	NN
cord-002410-2zi5iv2t	205	13	polymorphisms	polymorphism	NNS
cord-002410-2zi5iv2t	205	14	as	as	IN
cord-002410-2zi5iv2t	205	15	the	the	DT
cord-002410-2zi5iv2t	205	16	underlying	underlying	JJ
cord-002410-2zi5iv2t	205	17	genetic	genetic	JJ
cord-002410-2zi5iv2t	205	18	basis	basis	NN
cord-002410-2zi5iv2t	205	19	for	for	IN
cord-002410-2zi5iv2t	205	20	the	the	DT
cord-002410-2zi5iv2t	205	21	different	different	JJ
cord-002410-2zi5iv2t	205	22	IFN	IFN	NNP
cord-002410-2zi5iv2t	205	23	-	-	HYPH
cord-002410-2zi5iv2t	205	24	alpha	alpha	NNP
cord-002410-2zi5iv2t	205	25	/	/	SYM
cord-002410-2zi5iv2t	205	26	RBV	RBV	NNP
cord-002410-2zi5iv2t	205	27	treatment	treatment	NN
cord-002410-2zi5iv2t	205	28	responses	response	NNS
cord-002410-2zi5iv2t	205	29	as	as	RB
cord-002410-2zi5iv2t	205	30	well	well	RB
cord-002410-2zi5iv2t	205	31	as	as	IN
cord-002410-2zi5iv2t	205	32	for	for	IN
cord-002410-2zi5iv2t	205	33	different	different	JJ
cord-002410-2zi5iv2t	205	34	spontaneous	spontaneous	JJ
cord-002410-2zi5iv2t	205	35	clearance	clearance	NN
cord-002410-2zi5iv2t	205	36	rates	rate	NNS
cord-002410-2zi5iv2t	205	37	[	[	-LRB-
cord-002410-2zi5iv2t	205	38	111	111	CD
cord-002410-2zi5iv2t	205	39	,	,	,
cord-002410-2zi5iv2t	205	40	112	112	CD
cord-002410-2zi5iv2t	205	41	]	]	-RRB-
cord-002410-2zi5iv2t	205	42	.	.	.
cord-002410-2zi5iv2t	206	1	This	this	DT
cord-002410-2zi5iv2t	206	2	work	work	NN
cord-002410-2zi5iv2t	206	3	spurred	spur	VBD
cord-002410-2zi5iv2t	206	4	further	further	JJ
cord-002410-2zi5iv2t	206	5	investigations	investigation	NNS
cord-002410-2zi5iv2t	206	6	on	on	IN
cord-002410-2zi5iv2t	206	7	IFNL	IFNL	NNP
cord-002410-2zi5iv2t	206	8	gene	gene	NN
cord-002410-2zi5iv2t	206	9	SNPs	snp	NNS
cord-002410-2zi5iv2t	206	10	and	and	CC
cord-002410-2zi5iv2t	206	11	their	-PRON-	PRP$
cord-002410-2zi5iv2t	206	12	role	role	NN
cord-002410-2zi5iv2t	206	13	during	during	IN
cord-002410-2zi5iv2t	206	14	HCV	HCV	NNP
cord-002410-2zi5iv2t	206	15	infection	infection	NN
cord-002410-2zi5iv2t	206	16	and	and	CC
cord-002410-2zi5iv2t	206	17	treatment	treatment	NN
cord-002410-2zi5iv2t	206	18	.	.	.
cord-002410-2zi5iv2t	207	1	Three	three	CD
cord-002410-2zi5iv2t	207	2	major	major	JJ
cord-002410-2zi5iv2t	207	3	SNPs	snp	NNS
cord-002410-2zi5iv2t	207	4	near	near	IN
cord-002410-2zi5iv2t	207	5	the	the	DT
cord-002410-2zi5iv2t	207	6	IFNL3	ifnl3	NN
cord-002410-2zi5iv2t	207	7	and	and	CC
cord-002410-2zi5iv2t	207	8	IFNL4	ifnl4	NN
cord-002410-2zi5iv2t	207	9	genes	gene	NNS
cord-002410-2zi5iv2t	207	10	correlate	correlate	VBP
cord-002410-2zi5iv2t	207	11	with	with	IN
cord-002410-2zi5iv2t	207	12	HCV	HCV	NNP
cord-002410-2zi5iv2t	207	13	treatment	treatment	NN
cord-002410-2zi5iv2t	207	14	response	response	NN
cord-002410-2zi5iv2t	207	15	and	and	CC
cord-002410-2zi5iv2t	207	16	are	be	VBP
cord-002410-2zi5iv2t	207	17	in	in	IN
cord-002410-2zi5iv2t	207	18	high	high	JJ
cord-002410-2zi5iv2t	207	19	linkage	linkage	NN
cord-002410-2zi5iv2t	207	20	disequilibrium	disequilibrium	NN
cord-002410-2zi5iv2t	207	21	[	[	-LRB-
cord-002410-2zi5iv2t	207	22	113	113	CD
cord-002410-2zi5iv2t	207	23	,	,	,
cord-002410-2zi5iv2t	207	24	114	114	CD
cord-002410-2zi5iv2t	207	25	]	]	-RRB-
cord-002410-2zi5iv2t	207	26	.	.	.
cord-002410-2zi5iv2t	208	1	These	these	DT
cord-002410-2zi5iv2t	208	2	polymorphisms	polymorphism	NNS
cord-002410-2zi5iv2t	208	3	are	be	VBP
cord-002410-2zi5iv2t	208	4	rs12979860(C	rs12979860(C	NNP
cord-002410-2zi5iv2t	208	5	/	/	SYM
cord-002410-2zi5iv2t	208	6	T	T	NNP
cord-002410-2zi5iv2t	208	7	)	)	-RRB-
cord-002410-2zi5iv2t	208	8	located	locate	VBD
cord-002410-2zi5iv2t	208	9	3	3	CD
cord-002410-2zi5iv2t	208	10	kb	kb	NNP
cord-002410-2zi5iv2t	208	11	upstream	upstream	RB
cord-002410-2zi5iv2t	208	12	of	of	IN
cord-002410-2zi5iv2t	208	13	the	the	DT
cord-002410-2zi5iv2t	208	14	IFNL3	IFNL3	NNP
cord-002410-2zi5iv2t	208	15	gene	gene	NN
cord-002410-2zi5iv2t	208	16	[	[	-LRB-
cord-002410-2zi5iv2t	208	17	111	111	CD
cord-002410-2zi5iv2t	208	18	,	,	,
cord-002410-2zi5iv2t	208	19	112	112	CD
cord-002410-2zi5iv2t	208	20	]	]	-RRB-
cord-002410-2zi5iv2t	208	21	,	,	.
cord-002410-2zi5iv2t	209	1	rs8099917	rs8099917	.
cord-002410-2zi5iv2t	210	1	(	(	-LRB-
cord-002410-2zi5iv2t	210	2	T	T	NNP
cord-002410-2zi5iv2t	210	3	/	/	SYM
cord-002410-2zi5iv2t	210	4	G	G	NNP
cord-002410-2zi5iv2t	210	5	)	)	-RRB-
cord-002410-2zi5iv2t	210	6	located	locate	VBN
cord-002410-2zi5iv2t	210	7	between	between	IN
cord-002410-2zi5iv2t	210	8	the	the	DT
cord-002410-2zi5iv2t	210	9	IFNL2	IFNL2	NNS
cord-002410-2zi5iv2t	210	10	and	and	CC
cord-002410-2zi5iv2t	210	11	IFNL3	ifnl3	NN
cord-002410-2zi5iv2t	210	12	genes	gene	NNS
cord-002410-2zi5iv2t	210	13	[	[	-LRB-
cord-002410-2zi5iv2t	210	14	42	42	CD
cord-002410-2zi5iv2t	210	15	,	,	,
cord-002410-2zi5iv2t	210	16	115	115	CD
cord-002410-2zi5iv2t	210	17	]	]	-RRB-
cord-002410-2zi5iv2t	210	18	,	,	,
cord-002410-2zi5iv2t	210	19	and	and	CC
cord-002410-2zi5iv2t	210	20	rs368234815(TT	rs368234815(tt	JJ
cord-002410-2zi5iv2t	210	21	/	/	SYM
cord-002410-2zi5iv2t	210	22	ΔG	ΔG	NNP
cord-002410-2zi5iv2t	210	23	)	)	-RRB-
cord-002410-2zi5iv2t	210	24	(	(	-LRB-
cord-002410-2zi5iv2t	210	25	originally	originally	RB
cord-002410-2zi5iv2t	210	26	named	name	VBN
cord-002410-2zi5iv2t	210	27	ss469415590	ss469415590	NNP
cord-002410-2zi5iv2t	210	28	)	)	-RRB-
cord-002410-2zi5iv2t	210	29	,	,	,
cord-002410-2zi5iv2t	210	30	which	which	WDT
cord-002410-2zi5iv2t	210	31	creates	create	VBZ
cord-002410-2zi5iv2t	210	32	a	a	DT
cord-002410-2zi5iv2t	210	33	frameshift	frameshift	NN
cord-002410-2zi5iv2t	210	34	upstream	upstream	RB
cord-002410-2zi5iv2t	210	35	of	of	IN
cord-002410-2zi5iv2t	210	36	the	the	DT
cord-002410-2zi5iv2t	210	37	IFNL3	IFNL3	NNP
cord-002410-2zi5iv2t	210	38	gene	gene	NN
cord-002410-2zi5iv2t	210	39	leading	lead	VBG
cord-002410-2zi5iv2t	210	40	to	to	IN
cord-002410-2zi5iv2t	210	41	generation	generation	NN
cord-002410-2zi5iv2t	210	42	of	of	IN
cord-002410-2zi5iv2t	210	43	the	the	DT
cord-002410-2zi5iv2t	210	44	new	new	JJ
cord-002410-2zi5iv2t	210	45	IFNL4	ifnl4	NN
cord-002410-2zi5iv2t	210	46	gene	gene	NN
cord-002410-2zi5iv2t	210	47	product	product	NN
cord-002410-2zi5iv2t	210	48	[	[	-LRB-
cord-002410-2zi5iv2t	210	49	4	4	CD
cord-002410-2zi5iv2t	210	50	,	,	,
cord-002410-2zi5iv2t	210	51	38	38	CD
cord-002410-2zi5iv2t	210	52	,	,	,
cord-002410-2zi5iv2t	210	53	116	116	CD
cord-002410-2zi5iv2t	210	54	]	]	-RRB-
cord-002410-2zi5iv2t	210	55	.	.	.
cord-002410-2zi5iv2t	211	1	For	for	IN
cord-002410-2zi5iv2t	211	2	all	all	DT
cord-002410-2zi5iv2t	211	3	three	three	CD
cord-002410-2zi5iv2t	211	4	SNPs	SNPs	NNPS
cord-002410-2zi5iv2t	211	5	the	the	DT
cord-002410-2zi5iv2t	211	6	first	first	JJ
cord-002410-2zi5iv2t	211	7	allelic	allelic	JJ
cord-002410-2zi5iv2t	211	8	variant	variant	NN
cord-002410-2zi5iv2t	211	9	is	be	VBZ
cord-002410-2zi5iv2t	211	10	associated	associate	VBN
cord-002410-2zi5iv2t	211	11	with	with	IN
cord-002410-2zi5iv2t	211	12	a	a	DT
cord-002410-2zi5iv2t	211	13	higher	high	JJR
cord-002410-2zi5iv2t	211	14	probability	probability	NN
cord-002410-2zi5iv2t	211	15	of	of	IN
cord-002410-2zi5iv2t	211	16	sustained	sustained	JJ
cord-002410-2zi5iv2t	211	17	virological	virological	JJ
cord-002410-2zi5iv2t	211	18	response	response	NN
cord-002410-2zi5iv2t	211	19	to	to	IN
cord-002410-2zi5iv2t	211	20	IFN	IFN	NNP
cord-002410-2zi5iv2t	211	21	-	-	HYPH
cord-002410-2zi5iv2t	211	22	alpha	alpha	NNP
cord-002410-2zi5iv2t	211	23	/	/	SYM
cord-002410-2zi5iv2t	211	24	RBV	RBV	NNP
cord-002410-2zi5iv2t	211	25	treatment	treatment	NN
cord-002410-2zi5iv2t	211	26	.	.	.
cord-002410-2zi5iv2t	212	1	The	the	DT
cord-002410-2zi5iv2t	212	2	location	location	NN
cord-002410-2zi5iv2t	212	3	of	of	IN
cord-002410-2zi5iv2t	212	4	these	these	DT
cord-002410-2zi5iv2t	212	5	three	three	CD
cord-002410-2zi5iv2t	212	6	SNPs	SNPs	NNPS
cord-002410-2zi5iv2t	212	7	on	on	IN
cord-002410-2zi5iv2t	212	8	chromosome	chromosome	NN
cord-002410-2zi5iv2t	212	9	19	19	CD
cord-002410-2zi5iv2t	212	10	is	be	VBZ
cord-002410-2zi5iv2t	212	11	schematically	schematically	RB
cord-002410-2zi5iv2t	212	12	depicted	depict	VBN
cord-002410-2zi5iv2t	212	13	in	in	IN
cord-002410-2zi5iv2t	212	14	Figure	figure	NN
cord-002410-2zi5iv2t	212	15	4	4	CD
cord-002410-2zi5iv2t	212	16	.	.	.
cord-002410-2zi5iv2t	213	1	Treatment	treatment	NN
cord-002410-2zi5iv2t	213	2	response	response	NN
cord-002410-2zi5iv2t	213	3	dependency	dependency	NN
cord-002410-2zi5iv2t	213	4	on	on	IN
cord-002410-2zi5iv2t	213	5	IFNL	IFNL	NNP
cord-002410-2zi5iv2t	213	6	polymorphisms	polymorphism	NNS
cord-002410-2zi5iv2t	213	7	was	be	VBD
cord-002410-2zi5iv2t	213	8	demonstrated	demonstrate	VBN
cord-002410-2zi5iv2t	213	9	for	for	IN
cord-002410-2zi5iv2t	213	10	several	several	JJ
cord-002410-2zi5iv2t	213	11	HCV	HCV	NNP
cord-002410-2zi5iv2t	213	12	genotypes	genotype	NNS
cord-002410-2zi5iv2t	213	13	and	and	CC
cord-002410-2zi5iv2t	213	14	in	in	IN
cord-002410-2zi5iv2t	213	15	chronic	chronic	JJ
cord-002410-2zi5iv2t	213	16	patients	patient	NNS
cord-002410-2zi5iv2t	213	17	with	with	IN
cord-002410-2zi5iv2t	213	18	genotype	genotype	NN
cord-002410-2zi5iv2t	213	19	4	4	CD
cord-002410-2zi5iv2t	213	20	the	the	DT
cord-002410-2zi5iv2t	213	21	IFNL	IFNL	NNP
cord-002410-2zi5iv2t	213	22	SNPs	snp	NNS
cord-002410-2zi5iv2t	213	23	are	be	VBP
cord-002410-2zi5iv2t	213	24	the	the	DT
cord-002410-2zi5iv2t	213	25	strongest	strong	JJS
cord-002410-2zi5iv2t	213	26	predictors	predictor	NNS
cord-002410-2zi5iv2t	213	27	for	for	IN
cord-002410-2zi5iv2t	213	28	response	response	NN
cord-002410-2zi5iv2t	213	29	known	know	VBN
cord-002410-2zi5iv2t	213	30	to	to	IN
cord-002410-2zi5iv2t	213	31	date	date	NN
cord-002410-2zi5iv2t	213	32	[	[	-LRB-
cord-002410-2zi5iv2t	213	33	117	117	CD
cord-002410-2zi5iv2t	213	34	]	]	-RRB-
cord-002410-2zi5iv2t	213	35	.	.	.
cord-002410-2zi5iv2t	214	1	In	in	IN
cord-002410-2zi5iv2t	214	2	addition	addition	NN
cord-002410-2zi5iv2t	214	3	to	to	IN
cord-002410-2zi5iv2t	214	4	the	the	DT
cord-002410-2zi5iv2t	214	5	three	three	CD
cord-002410-2zi5iv2t	214	6	above	above	IN
cord-002410-2zi5iv2t	214	7	described	describe	VBN
cord-002410-2zi5iv2t	214	8	SNPs	SNPs	NNP
cord-002410-2zi5iv2t	214	9	,	,	,
cord-002410-2zi5iv2t	214	10	six	six	CD
cord-002410-2zi5iv2t	214	11	additional	additional	JJ
cord-002410-2zi5iv2t	214	12	SNPs	snp	NNS
cord-002410-2zi5iv2t	214	13	in	in	IN
cord-002410-2zi5iv2t	214	14	the	the	DT
cord-002410-2zi5iv2t	214	15	IFNL	IFNL	NNP
cord-002410-2zi5iv2t	214	16	locus	locus	NN
cord-002410-2zi5iv2t	214	17	have	have	VBP
cord-002410-2zi5iv2t	214	18	been	be	VBN
cord-002410-2zi5iv2t	214	19	described	describe	VBN
cord-002410-2zi5iv2t	214	20	to	to	TO
cord-002410-2zi5iv2t	214	21	strongly	strongly	RB
cord-002410-2zi5iv2t	214	22	associate	associate	VB
cord-002410-2zi5iv2t	214	23	with	with	IN
cord-002410-2zi5iv2t	214	24	sustained	sustained	JJ
cord-002410-2zi5iv2t	214	25	virological	virological	JJ
cord-002410-2zi5iv2t	214	26	response	response	NN
cord-002410-2zi5iv2t	214	27	after	after	IN
cord-002410-2zi5iv2t	214	28	IFN	IFN	NNP
cord-002410-2zi5iv2t	214	29	-	-	HYPH
cord-002410-2zi5iv2t	214	30	alpha	alpha	NNP
cord-002410-2zi5iv2t	214	31	/	/	SYM
cord-002410-2zi5iv2t	214	32	RBV	RBV	NNP
cord-002410-2zi5iv2t	214	33	treatment	treatment	NN
cord-002410-2zi5iv2t	214	34	(	(	-LRB-
cord-002410-2zi5iv2t	214	35	rs8105790	rs8105790	NNP
cord-002410-2zi5iv2t	214	36	,	,	,
cord-002410-2zi5iv2t	214	37	rs11881222	rs11881222	NNP
cord-002410-2zi5iv2t	214	38	,	,	,
cord-002410-2zi5iv2t	214	39	rs8103142	rs8103142	NNP
cord-002410-2zi5iv2t	214	40	,	,	,
cord-002410-2zi5iv2t	214	41	rs28416813	rs28416813	NNP
cord-002410-2zi5iv2t	214	42	,	,	,
cord-002410-2zi5iv2t	214	43	rs4803219	rs4803219	NNP
cord-002410-2zi5iv2t	214	44	,	,	,
cord-002410-2zi5iv2t	214	45	and	and	CC
cord-002410-2zi5iv2t	214	46	rs7248668	rs7248668	LS
cord-002410-2zi5iv2t	214	47	)	)	-RRB-
cord-002410-2zi5iv2t	214	48	[	[	-LRB-
cord-002410-2zi5iv2t	214	49	115	115	CD
cord-002410-2zi5iv2t	214	50	]	]	-RRB-
cord-002410-2zi5iv2t	214	51	.	.	.
cord-002410-2zi5iv2t	215	1	How	how	WRB
cord-002410-2zi5iv2t	215	2	the	the	DT
cord-002410-2zi5iv2t	215	3	IFNL	IFNL	NNP
cord-002410-2zi5iv2t	215	4	SNPs	snp	NNS
cord-002410-2zi5iv2t	215	5	mechanistically	mechanistically	RB
cord-002410-2zi5iv2t	215	6	influence	influence	VBP
cord-002410-2zi5iv2t	215	7	treatment	treatment	NN
cord-002410-2zi5iv2t	215	8	outcome	outcome	NN
cord-002410-2zi5iv2t	215	9	is	be	VBZ
cord-002410-2zi5iv2t	215	10	mostly	mostly	RB
cord-002410-2zi5iv2t	215	11	unclear	unclear	JJ
cord-002410-2zi5iv2t	215	12	.	.	.
cord-002410-2zi5iv2t	216	1	Initially	initially	RB
cord-002410-2zi5iv2t	216	2	,	,	,
cord-002410-2zi5iv2t	216	3	it	-PRON-	PRP
cord-002410-2zi5iv2t	216	4	was	be	VBD
cord-002410-2zi5iv2t	216	5	suspected	suspect	VBN
cord-002410-2zi5iv2t	216	6	that	that	IN
cord-002410-2zi5iv2t	216	7	the	the	DT
cord-002410-2zi5iv2t	216	8	SNPs	SNPs	NNPS
cord-002410-2zi5iv2t	216	9	alter	alter	VBP
cord-002410-2zi5iv2t	216	10	the	the	DT
cord-002410-2zi5iv2t	216	11	transcriptional	transcriptional	JJ
cord-002410-2zi5iv2t	216	12	regulation	regulation	NN
cord-002410-2zi5iv2t	216	13	of	of	IN
cord-002410-2zi5iv2t	216	14	IFNL3	IFNL3	NNP
cord-002410-2zi5iv2t	216	15	as	as	IN
cord-002410-2zi5iv2t	216	16	they	-PRON-	PRP
cord-002410-2zi5iv2t	216	17	are	be	VBP
cord-002410-2zi5iv2t	216	18	located	locate	VBN
cord-002410-2zi5iv2t	216	19	upstream	upstream	RB
cord-002410-2zi5iv2t	216	20	of	of	IN
cord-002410-2zi5iv2t	216	21	the	the	DT
cord-002410-2zi5iv2t	216	22	IFNL3	ifnl3	NN
cord-002410-2zi5iv2t	216	23	coding	code	VBG
cord-002410-2zi5iv2t	216	24	sequence	sequence	NN
cord-002410-2zi5iv2t	216	25	,	,	,
cord-002410-2zi5iv2t	216	26	where	where	WRB
cord-002410-2zi5iv2t	216	27	they	-PRON-	PRP
cord-002410-2zi5iv2t	216	28	could	could	MD
cord-002410-2zi5iv2t	216	29	influence	influence	VB
cord-002410-2zi5iv2t	216	30	transcription	transcription	NN
cord-002410-2zi5iv2t	216	31	factor	factor	NN
cord-002410-2zi5iv2t	216	32	binding	bind	VBG
cord-002410-2zi5iv2t	216	33	and	and	CC
cord-002410-2zi5iv2t	216	34	DNA	dna	NN
cord-002410-2zi5iv2t	216	35	methylation	methylation	NN
cord-002410-2zi5iv2t	216	36	.	.	.
cord-002410-2zi5iv2t	217	1	However	however	RB
cord-002410-2zi5iv2t	217	2	,	,	,
cord-002410-2zi5iv2t	217	3	while	while	IN
cord-002410-2zi5iv2t	217	4	some	some	DT
cord-002410-2zi5iv2t	217	5	studies	study	NNS
cord-002410-2zi5iv2t	217	6	detect	detect	VBP
cord-002410-2zi5iv2t	217	7	a	a	DT
cord-002410-2zi5iv2t	217	8	correlation	correlation	NN
cord-002410-2zi5iv2t	217	9	of	of	IN
cord-002410-2zi5iv2t	217	10	protective	protective	JJ
cord-002410-2zi5iv2t	217	11	IFNL	IFNL	NNP
cord-002410-2zi5iv2t	217	12	SNPs	snp	NNS
cord-002410-2zi5iv2t	217	13	and	and	CC
cord-002410-2zi5iv2t	217	14	higher	high	JJR
cord-002410-2zi5iv2t	217	15	IFNL	IFNL	NNP
cord-002410-2zi5iv2t	217	16	expression	expression	NN
cord-002410-2zi5iv2t	217	17	levels	level	NNS
cord-002410-2zi5iv2t	217	18	,	,	,
cord-002410-2zi5iv2t	217	19	other	other	JJ
cord-002410-2zi5iv2t	217	20	fail	fail	VBP
cord-002410-2zi5iv2t	217	21	to	to	TO
cord-002410-2zi5iv2t	217	22	do	do	VB
cord-002410-2zi5iv2t	217	23	so	so	RB
cord-002410-2zi5iv2t	218	1	(	(	-LRB-
cord-002410-2zi5iv2t	218	2	see	see	VB
cord-002410-2zi5iv2t	218	3	[	[	-LRB-
cord-002410-2zi5iv2t	218	4	39	39	CD
cord-002410-2zi5iv2t	218	5	]	]	-RRB-
cord-002410-2zi5iv2t	218	6	for	for	IN
cord-002410-2zi5iv2t	218	7	detailed	detailed	JJ
cord-002410-2zi5iv2t	218	8	description	description	NN
cord-002410-2zi5iv2t	218	9	)	)	-RRB-
cord-002410-2zi5iv2t	218	10	.	.	.
cord-002410-2zi5iv2t	219	1	Mechanistically	Mechanistically	NNP
cord-002410-2zi5iv2t	219	2	,	,	,
cord-002410-2zi5iv2t	219	3	the	the	DT
cord-002410-2zi5iv2t	219	4	rs8099917	rs8099917	NNP
cord-002410-2zi5iv2t	219	5	SNP	SNP	NNP
cord-002410-2zi5iv2t	219	6	has	have	VBZ
cord-002410-2zi5iv2t	219	7	been	be	VBN
cord-002410-2zi5iv2t	219	8	suggested	suggest	VBN
cord-002410-2zi5iv2t	219	9	to	to	TO
cord-002410-2zi5iv2t	219	10	influence	influence	VB
cord-002410-2zi5iv2t	219	11	IFNL3	IFNL3	NNP
cord-002410-2zi5iv2t	219	12	mRNA	mrna	NN
cord-002410-2zi5iv2t	219	13	stability	stability	NN
cord-002410-2zi5iv2t	219	14	with	with	IN
cord-002410-2zi5iv2t	219	15	the	the	DT
cord-002410-2zi5iv2t	219	16	favorable	favorable	JJ
cord-002410-2zi5iv2t	219	17	allele	allele	NN
cord-002410-2zi5iv2t	219	18	being	be	VBG
cord-002410-2zi5iv2t	219	19	more	more	RBR
cord-002410-2zi5iv2t	219	20	stable	stable	JJ
cord-002410-2zi5iv2t	219	21	[	[	-LRB-
cord-002410-2zi5iv2t	219	22	118	118	CD
cord-002410-2zi5iv2t	219	23	]	]	-RRB-
cord-002410-2zi5iv2t	219	24	.	.	.
cord-002410-2zi5iv2t	220	1	For	for	IN
cord-002410-2zi5iv2t	220	2	the	the	DT
cord-002410-2zi5iv2t	220	3	rs368234815(TT	rs368234815(tt	JJ
cord-002410-2zi5iv2t	220	4	/	/	SYM
cord-002410-2zi5iv2t	220	5	ΔG	ΔG	NNP
cord-002410-2zi5iv2t	220	6	)	)	-RRB-
cord-002410-2zi5iv2t	220	7	SNP	SNP	NNP
cord-002410-2zi5iv2t	220	8	the	the	DT
cord-002410-2zi5iv2t	220	9	functional	functional	JJ
cord-002410-2zi5iv2t	220	10	impact	impact	NN
cord-002410-2zi5iv2t	220	11	is	be	VBZ
cord-002410-2zi5iv2t	220	12	best	well	RBS
cord-002410-2zi5iv2t	220	13	described	describe	VBN
cord-002410-2zi5iv2t	220	14	[	[	-LRB-
cord-002410-2zi5iv2t	220	15	4	4	CD
cord-002410-2zi5iv2t	220	16	]	]	-RRB-
cord-002410-2zi5iv2t	220	17	.	.	.
cord-002410-2zi5iv2t	221	1	The	the	DT
cord-002410-2zi5iv2t	221	2	ΔG	ΔG	NNP
cord-002410-2zi5iv2t	221	3	variant	variant	NN
cord-002410-2zi5iv2t	221	4	results	result	VBZ
cord-002410-2zi5iv2t	221	5	in	in	IN
cord-002410-2zi5iv2t	221	6	the	the	DT
cord-002410-2zi5iv2t	221	7	expression	expression	NN
cord-002410-2zi5iv2t	221	8	of	of	IN
cord-002410-2zi5iv2t	221	9	IFNL4	ifnl4	NN
cord-002410-2zi5iv2t	221	10	,	,	,
cord-002410-2zi5iv2t	221	11	which	which	WDT
cord-002410-2zi5iv2t	221	12	is	be	VBZ
cord-002410-2zi5iv2t	221	13	a	a	DT
cord-002410-2zi5iv2t	221	14	pseudogene	pseudogene	NN
cord-002410-2zi5iv2t	221	15	in	in	IN
cord-002410-2zi5iv2t	221	16	TT	TT	NNP
cord-002410-2zi5iv2t	221	17	carriers	carrier	NNS
cord-002410-2zi5iv2t	221	18	.	.	.
cord-002410-2zi5iv2t	222	1	IFNL4	IFNL4	NNP
cord-002410-2zi5iv2t	222	2	expression	expression	NN
cord-002410-2zi5iv2t	222	3	is	be	VBZ
cord-002410-2zi5iv2t	222	4	associated	associate	VBN
cord-002410-2zi5iv2t	222	5	with	with	IN
cord-002410-2zi5iv2t	222	6	increased	increase	VBN
cord-002410-2zi5iv2t	222	7	ISG	ISG	NNP
cord-002410-2zi5iv2t	222	8	levels	level	NNS
cord-002410-2zi5iv2t	222	9	and	and	CC
cord-002410-2zi5iv2t	222	10	this	this	DT
cord-002410-2zi5iv2t	222	11	in	in	IN
cord-002410-2zi5iv2t	222	12	turn	turn	NN
cord-002410-2zi5iv2t	222	13	worsens	worsen	VBZ
cord-002410-2zi5iv2t	222	14	treatment	treatment	NN
cord-002410-2zi5iv2t	222	15	outcome	outcome	NN
cord-002410-2zi5iv2t	222	16	.	.	.
cord-002410-2zi5iv2t	223	1	While	while	IN
cord-002410-2zi5iv2t	223	2	this	this	DT
cord-002410-2zi5iv2t	223	3	might	may	MD
cord-002410-2zi5iv2t	223	4	seem	seem	VB
cord-002410-2zi5iv2t	223	5	counterintuitive	counterintuitive	JJ
cord-002410-2zi5iv2t	223	6	,	,	,
cord-002410-2zi5iv2t	223	7	it	-PRON-	PRP
cord-002410-2zi5iv2t	223	8	is	be	VBZ
cord-002410-2zi5iv2t	223	9	in	in	IN
cord-002410-2zi5iv2t	223	10	line	line	NN
cord-002410-2zi5iv2t	223	11	with	with	IN
cord-002410-2zi5iv2t	223	12	observations	observation	NNS
cord-002410-2zi5iv2t	223	13	that	that	IN
cord-002410-2zi5iv2t	223	14	patients	patient	NNS
cord-002410-2zi5iv2t	223	15	with	with	IN
cord-002410-2zi5iv2t	223	16	increased	increase	VBN
cord-002410-2zi5iv2t	223	17	pretreatment	pretreatment	NN
cord-002410-2zi5iv2t	223	18	ISG	ISG	NNP
cord-002410-2zi5iv2t	223	19	levels	level	NNS
cord-002410-2zi5iv2t	223	20	in	in	IN
cord-002410-2zi5iv2t	223	21	the	the	DT
cord-002410-2zi5iv2t	223	22	liver	liver	NN
cord-002410-2zi5iv2t	223	23	respond	respond	VBP
cord-002410-2zi5iv2t	223	24	more	more	RBR
cord-002410-2zi5iv2t	223	25	poorly	poorly	RB
cord-002410-2zi5iv2t	223	26	to	to	IN
cord-002410-2zi5iv2t	223	27	IFN	IFN	NNP
cord-002410-2zi5iv2t	223	28	-	-	HYPH
cord-002410-2zi5iv2t	223	29	alpha	alpha	NNP
cord-002410-2zi5iv2t	223	30	/	/	SYM
cord-002410-2zi5iv2t	223	31	RBV	RBV	NNP
cord-002410-2zi5iv2t	223	32	therapy	therapy	NN
cord-002410-2zi5iv2t	223	33	[	[	-LRB-
cord-002410-2zi5iv2t	223	34	119	119	CD
cord-002410-2zi5iv2t	223	35	]	]	-RRB-
cord-002410-2zi5iv2t	223	36	[	[	-LRB-
cord-002410-2zi5iv2t	223	37	120	120	CD
cord-002410-2zi5iv2t	223	38	]	]	-RRB-
cord-002410-2zi5iv2t	223	39	[	[	-LRB-
cord-002410-2zi5iv2t	223	40	121	121	CD
cord-002410-2zi5iv2t	223	41	]	]	-RRB-
cord-002410-2zi5iv2t	223	42	.	.	.
cord-002410-2zi5iv2t	224	1	Thus	thus	RB
cord-002410-2zi5iv2t	224	2	,	,	,
cord-002410-2zi5iv2t	224	3	it	-PRON-	PRP
cord-002410-2zi5iv2t	224	4	seems	seem	VBZ
cord-002410-2zi5iv2t	224	5	at	at	IN
cord-002410-2zi5iv2t	224	6	least	least	JJS
cord-002410-2zi5iv2t	224	7	in	in	IN
cord-002410-2zi5iv2t	224	8	the	the	DT
cord-002410-2zi5iv2t	224	9	case	case	NN
cord-002410-2zi5iv2t	224	10	of	of	IN
cord-002410-2zi5iv2t	224	11	IFNL4	ifnl4	NN
cord-002410-2zi5iv2t	224	12	that	that	IN
cord-002410-2zi5iv2t	224	13	it	-PRON-	PRP
cord-002410-2zi5iv2t	224	14	has	have	VBZ
cord-002410-2zi5iv2t	224	15	an	an	DT
cord-002410-2zi5iv2t	224	16	adverse	adverse	JJ
cord-002410-2zi5iv2t	224	17	effect	effect	NN
cord-002410-2zi5iv2t	224	18	during	during	IN
cord-002410-2zi5iv2t	224	19	hepatitis	hepatitis	NN
cord-002410-2zi5iv2t	224	20	C	C	NNP
cord-002410-2zi5iv2t	224	21	by	by	IN
cord-002410-2zi5iv2t	224	22	desensitizing	desensitize	VBG
cord-002410-2zi5iv2t	224	23	the	the	DT
cord-002410-2zi5iv2t	224	24	liver	liver	NN
cord-002410-2zi5iv2t	224	25	to	to	IN
cord-002410-2zi5iv2t	224	26	IFN	IFN	NNP
cord-002410-2zi5iv2t	224	27	-	-	HYPH
cord-002410-2zi5iv2t	224	28	alpha	alpha	NNP
cord-002410-2zi5iv2t	224	29	/	/	SYM
cord-002410-2zi5iv2t	224	30	RBV	RBV	NNP
cord-002410-2zi5iv2t	224	31	treatment	treatment	NN
cord-002410-2zi5iv2t	224	32	.	.	.
cord-002410-2zi5iv2t	225	1	This	this	DT
cord-002410-2zi5iv2t	225	2	has	have	VBZ
cord-002410-2zi5iv2t	225	3	been	be	VBN
cord-002410-2zi5iv2t	225	4	confirmed	confirm	VBN
cord-002410-2zi5iv2t	225	5	in	in	IN
cord-002410-2zi5iv2t	225	6	an	an	DT
cord-002410-2zi5iv2t	225	7	independent	independent	JJ
cord-002410-2zi5iv2t	225	8	study	study	NN
cord-002410-2zi5iv2t	225	9	on	on	IN
cord-002410-2zi5iv2t	225	10	the	the	DT
cord-002410-2zi5iv2t	225	11	IFNL4	ifnl4	NN
cord-002410-2zi5iv2t	225	12	coding	code	VBG
cord-002410-2zi5iv2t	225	13	SNP	SNP	NNP
cord-002410-2zi5iv2t	225	14	rs117648444	rs117648444	NNP
cord-002410-2zi5iv2t	225	15	[	[	-LRB-
cord-002410-2zi5iv2t	225	16	90	90	CD
cord-002410-2zi5iv2t	225	17	]	]	-RRB-
cord-002410-2zi5iv2t	225	18	,	,	,
cord-002410-2zi5iv2t	225	19	which	which	WDT
cord-002410-2zi5iv2t	225	20	results	result	VBZ
cord-002410-2zi5iv2t	225	21	in	in	IN
cord-002410-2zi5iv2t	225	22	a	a	DT
cord-002410-2zi5iv2t	225	23	less	less	RBR
cord-002410-2zi5iv2t	225	24	active	active	JJ
cord-002410-2zi5iv2t	225	25	IFNL4	ifnl4	NN
cord-002410-2zi5iv2t	225	26	variant	variant	NN
cord-002410-2zi5iv2t	225	27	and	and	CC
cord-002410-2zi5iv2t	225	28	consequently	consequently	RB
cord-002410-2zi5iv2t	225	29	in	in	IN
cord-002410-2zi5iv2t	225	30	improved	improve	VBN
cord-002410-2zi5iv2t	225	31	treatment	treatment	NN
cord-002410-2zi5iv2t	225	32	response	response	NN
cord-002410-2zi5iv2t	225	33	.	.	.
cord-002410-2zi5iv2t	226	1	While	while	IN
cord-002410-2zi5iv2t	226	2	one	one	PRP
cord-002410-2zi5iv2t	226	3	might	may	MD
cord-002410-2zi5iv2t	226	4	question	question	VB
cord-002410-2zi5iv2t	226	5	the	the	DT
cord-002410-2zi5iv2t	226	6	value	value	NN
cord-002410-2zi5iv2t	226	7	of	of	IN
cord-002410-2zi5iv2t	226	8	these	these	DT
cord-002410-2zi5iv2t	226	9	genetic	genetic	JJ
cord-002410-2zi5iv2t	226	10	markers	marker	NNS
cord-002410-2zi5iv2t	226	11	in	in	IN
cord-002410-2zi5iv2t	226	12	the	the	DT
cord-002410-2zi5iv2t	226	13	age	age	NN
cord-002410-2zi5iv2t	226	14	of	of	IN
cord-002410-2zi5iv2t	226	15	IFNfree	IFNfree	NNP
cord-002410-2zi5iv2t	226	16	DAA	DAA	NNP
cord-002410-2zi5iv2t	226	17	treatment	treatment	NN
cord-002410-2zi5iv2t	226	18	with	with	IN
cord-002410-2zi5iv2t	226	19	high	high	JJ
cord-002410-2zi5iv2t	226	20	cure	cure	NN
cord-002410-2zi5iv2t	226	21	rates	rate	NNS
cord-002410-2zi5iv2t	226	22	,	,	,
cord-002410-2zi5iv2t	226	23	it	-PRON-	PRP
cord-002410-2zi5iv2t	226	24	should	should	MD
cord-002410-2zi5iv2t	226	25	be	be	VB
cord-002410-2zi5iv2t	226	26	noted	note	VBN
cord-002410-2zi5iv2t	226	27	that	that	IN
cord-002410-2zi5iv2t	226	28	IFNL	IFNL	NNP
cord-002410-2zi5iv2t	226	29	locus	locus	NN
cord-002410-2zi5iv2t	226	30	SNPs	snp	NNS
cord-002410-2zi5iv2t	226	31	are	be	VBP
cord-002410-2zi5iv2t	226	32	also	also	RB
cord-002410-2zi5iv2t	226	33	predictive	predictive	JJ
cord-002410-2zi5iv2t	226	34	for	for	IN
cord-002410-2zi5iv2t	226	35	DAA	DAA	NNP
cord-002410-2zi5iv2t	226	36	treatment	treatment	NN
cord-002410-2zi5iv2t	226	37	outcome	outcome	NN
cord-002410-2zi5iv2t	226	38	and	and	CC
cord-002410-2zi5iv2t	226	39	moreover	moreover	RB
cord-002410-2zi5iv2t	226	40	influence	influence	VBP
cord-002410-2zi5iv2t	226	41	the	the	DT
cord-002410-2zi5iv2t	226	42	DAA	DAA	NNP
cord-002410-2zi5iv2t	226	43	response	response	NN
cord-002410-2zi5iv2t	226	44	kinetics	kinetic	NNS
cord-002410-2zi5iv2t	226	45	[	[	-LRB-
cord-002410-2zi5iv2t	226	46	122	122	CD
cord-002410-2zi5iv2t	226	47	]	]	-RRB-
cord-002410-2zi5iv2t	227	1	[	[	-LRB-
cord-002410-2zi5iv2t	227	2	123	123	CD
cord-002410-2zi5iv2t	227	3	]	]	-RRB-
cord-002410-2zi5iv2t	227	4	[	[	-LRB-
cord-002410-2zi5iv2t	227	5	124	124	CD
cord-002410-2zi5iv2t	227	6	]	]	-RRB-
cord-002410-2zi5iv2t	227	7	.	.	.
cord-002410-2zi5iv2t	228	1	Genetic	genetic	JJ
cord-002410-2zi5iv2t	228	2	markers	marker	NNS
cord-002410-2zi5iv2t	228	3	might	may	MD
cord-002410-2zi5iv2t	228	4	therefore	therefore	RB
cord-002410-2zi5iv2t	228	5	allow	allow	VB
cord-002410-2zi5iv2t	228	6	prediction	prediction	NN
cord-002410-2zi5iv2t	228	7	of	of	IN
cord-002410-2zi5iv2t	228	8	treatment	treatment	NN
cord-002410-2zi5iv2t	228	9	duration	duration	NN
cord-002410-2zi5iv2t	228	10	and	and	CC
cord-002410-2zi5iv2t	228	11	consequently	consequently	RB
cord-002410-2zi5iv2t	228	12	reduce	reduce	VB
cord-002410-2zi5iv2t	228	13	costs	cost	NNS
cord-002410-2zi5iv2t	228	14	and	and	CC
cord-002410-2zi5iv2t	228	15	exposure	exposure	NN
cord-002410-2zi5iv2t	228	16	time	time	NN
cord-002410-2zi5iv2t	228	17	to	to	IN
cord-002410-2zi5iv2t	228	18	DAAs	DAAs	NNP
cord-002410-2zi5iv2t	228	19	.	.	.
cord-002410-2zi5iv2t	229	1	Human	human	JJ
cord-002410-2zi5iv2t	229	2	polymorphisms	polymorphism	NNS
cord-002410-2zi5iv2t	229	3	in	in	IN
cord-002410-2zi5iv2t	229	4	the	the	DT
cord-002410-2zi5iv2t	229	5	IFNL	IFNL	NNP
cord-002410-2zi5iv2t	229	6	locus	locus	NN
cord-002410-2zi5iv2t	229	7	responsible	responsible	JJ
cord-002410-2zi5iv2t	229	8	for	for	IN
cord-002410-2zi5iv2t	229	9	improved	improved	JJ
cord-002410-2zi5iv2t	229	10	response	response	NN
cord-002410-2zi5iv2t	229	11	to	to	IN
cord-002410-2zi5iv2t	229	12	IFN	IFN	NNP
cord-002410-2zi5iv2t	229	13	-	-	HYPH
cord-002410-2zi5iv2t	229	14	alpha	alpha	NNP
cord-002410-2zi5iv2t	229	15	/	/	SYM
cord-002410-2zi5iv2t	229	16	RBV	RBV	NNP
cord-002410-2zi5iv2t	229	17	treatment	treatment	NN
cord-002410-2zi5iv2t	229	18	are	be	VBP
cord-002410-2zi5iv2t	229	19	also	also	RB
cord-002410-2zi5iv2t	229	20	associated	associate	VBN
cord-002410-2zi5iv2t	229	21	with	with	IN
cord-002410-2zi5iv2t	229	22	better	well	JJR
cord-002410-2zi5iv2t	229	23	spontaneous	spontaneous	JJ
cord-002410-2zi5iv2t	229	24	clearance	clearance	NN
cord-002410-2zi5iv2t	229	25	of	of	IN
cord-002410-2zi5iv2t	229	26	HCV	HCV	NNP
cord-002410-2zi5iv2t	229	27	.	.	.
cord-002410-2zi5iv2t	230	1	Allele	allele	NN
cord-002410-2zi5iv2t	230	2	frequency	frequency	NN
cord-002410-2zi5iv2t	230	3	of	of	IN
cord-002410-2zi5iv2t	230	4	the	the	DT
cord-002410-2zi5iv2t	230	5	rs12979860	rs12979860	NN
cord-002410-2zi5iv2t	230	6	SNP	SNP	NNP
cord-002410-2zi5iv2t	230	7	differs	differ	VBZ
cord-002410-2zi5iv2t	230	8	between	between	IN
cord-002410-2zi5iv2t	230	9	individuals	individual	NNS
cord-002410-2zi5iv2t	230	10	with	with	IN
cord-002410-2zi5iv2t	230	11	European	european	JJ
cord-002410-2zi5iv2t	230	12	or	or	CC
cord-002410-2zi5iv2t	230	13	African	african	JJ
cord-002410-2zi5iv2t	230	14	ancestry	ancestry	NN
cord-002410-2zi5iv2t	230	15	with	with	IN
cord-002410-2zi5iv2t	230	16	the	the	DT
cord-002410-2zi5iv2t	230	17	favorable	favorable	JJ
cord-002410-2zi5iv2t	230	18	rs12979860(C	rs12979860(c	CD
cord-002410-2zi5iv2t	230	19	)	)	-RRB-
cord-002410-2zi5iv2t	230	20	variant	variant	NN
cord-002410-2zi5iv2t	230	21	predominating	predominate	VBG
cord-002410-2zi5iv2t	230	22	in	in	IN
cord-002410-2zi5iv2t	230	23	the	the	DT
cord-002410-2zi5iv2t	230	24	former	former	JJ
cord-002410-2zi5iv2t	230	25	population	population	NN
cord-002410-2zi5iv2t	230	26	.	.	.
cord-002410-2zi5iv2t	231	1	This	this	DT
cord-002410-2zi5iv2t	231	2	finding	finding	NN
cord-002410-2zi5iv2t	231	3	correlates	correlate	VBZ
cord-002410-2zi5iv2t	231	4	with	with	IN
cord-002410-2zi5iv2t	231	5	better	well	JJR
cord-002410-2zi5iv2t	231	6	clearance	clearance	NN
cord-002410-2zi5iv2t	231	7	of	of	IN
cord-002410-2zi5iv2t	231	8	HCV	HCV	NNP
cord-002410-2zi5iv2t	231	9	in	in	IN
cord-002410-2zi5iv2t	231	10	European	european	JJ
cord-002410-2zi5iv2t	231	11	ancestry	ancestry	NN
cord-002410-2zi5iv2t	231	12	individuals	individual	NNS
cord-002410-2zi5iv2t	231	13	.	.	.
cord-002410-2zi5iv2t	232	1	The	the	DT
cord-002410-2zi5iv2t	232	2	rs368234815(TT	rs368234815(tt	JJ
cord-002410-2zi5iv2t	232	3	/	/	SYM
cord-002410-2zi5iv2t	232	4	ΔG	ΔG	NNP
cord-002410-2zi5iv2t	232	5	)	)	-RRB-
cord-002410-2zi5iv2t	233	1	SNP	SNP	NNP
cord-002410-2zi5iv2t	233	2	similarly	similarly	RB
cord-002410-2zi5iv2t	233	3	predicts	predict	VBZ
cord-002410-2zi5iv2t	233	4	HCV	HCV	NNP
cord-002410-2zi5iv2t	233	5	clearance	clearance	NN
cord-002410-2zi5iv2t	233	6	rates	rate	NNS
cord-002410-2zi5iv2t	233	7	.	.	.
cord-002410-2zi5iv2t	234	1	However	however	RB
cord-002410-2zi5iv2t	234	2	,	,	,
cord-002410-2zi5iv2t	234	3	it	-PRON-	PRP
cord-002410-2zi5iv2t	234	4	is	be	VBZ
cord-002410-2zi5iv2t	234	5	a	a	DT
cord-002410-2zi5iv2t	234	6	better	well	JJR
cord-002410-2zi5iv2t	234	7	predictor	predictor	NN
cord-002410-2zi5iv2t	234	8	than	than	IN
cord-002410-2zi5iv2t	234	9	the	the	DT
cord-002410-2zi5iv2t	234	10	rs12979860	rs12979860	NN
cord-002410-2zi5iv2t	234	11	SNP	SNP	NNP
cord-002410-2zi5iv2t	234	12	in	in	IN
cord-002410-2zi5iv2t	234	13	African	African	NNP
cord-002410-2zi5iv2t	234	14	-	-	HYPH
cord-002410-2zi5iv2t	234	15	Americans	Americans	NNPS
cord-002410-2zi5iv2t	234	16	,	,	,
cord-002410-2zi5iv2t	234	17	while	while	IN
cord-002410-2zi5iv2t	234	18	the	the	DT
cord-002410-2zi5iv2t	234	19	predictive	predictive	JJ
cord-002410-2zi5iv2t	234	20	value	value	NN
cord-002410-2zi5iv2t	234	21	of	of	IN
cord-002410-2zi5iv2t	234	22	both	both	DT
cord-002410-2zi5iv2t	234	23	SNPs	SNPs	NNPS
cord-002410-2zi5iv2t	234	24	is	be	VBZ
cord-002410-2zi5iv2t	234	25	similar	similar	JJ
cord-002410-2zi5iv2t	234	26	in	in	IN
cord-002410-2zi5iv2t	234	27	European	European	NNP
cord-002410-2zi5iv2t	234	28	-	-	HYPH
cord-002410-2zi5iv2t	234	29	Americans	Americans	NNPS
cord-002410-2zi5iv2t	234	30	[	[	-LRB-
cord-002410-2zi5iv2t	234	31	4	4	CD
cord-002410-2zi5iv2t	234	32	,	,	,
cord-002410-2zi5iv2t	234	33	125	125	CD
cord-002410-2zi5iv2t	234	34	]	]	-RRB-
cord-002410-2zi5iv2t	234	35	.	.	.
cord-002410-2zi5iv2t	235	1	Causative	causative	JJ
cord-002410-2zi5iv2t	235	2	for	for	IN
cord-002410-2zi5iv2t	235	3	this	this	DT
cord-002410-2zi5iv2t	235	4	difference	difference	NN
cord-002410-2zi5iv2t	235	5	is	be	VBZ
cord-002410-2zi5iv2t	235	6	the	the	DT
cord-002410-2zi5iv2t	235	7	degree	degree	NN
cord-002410-2zi5iv2t	235	8	of	of	IN
cord-002410-2zi5iv2t	235	9	linkage	linkage	NN
cord-002410-2zi5iv2t	235	10	disequilibrium	disequilibrium	NN
cord-002410-2zi5iv2t	235	11	between	between	IN
cord-002410-2zi5iv2t	235	12	both	both	DT
cord-002410-2zi5iv2t	235	13	SNPs	snp	NNS
cord-002410-2zi5iv2t	235	14	in	in	IN
cord-002410-2zi5iv2t	235	15	the	the	DT
cord-002410-2zi5iv2t	235	16	two	two	CD
cord-002410-2zi5iv2t	235	17	populations	population	NNS
cord-002410-2zi5iv2t	235	18	[	[	-LRB-
cord-002410-2zi5iv2t	235	19	116	116	CD
cord-002410-2zi5iv2t	235	20	]	]	-RRB-
cord-002410-2zi5iv2t	235	21	.	.	.
cord-002410-2zi5iv2t	236	1	The	the	DT
cord-002410-2zi5iv2t	236	2	third	third	JJ
cord-002410-2zi5iv2t	236	3	SNP	SNP	NNP
cord-002410-2zi5iv2t	236	4	with	with	IN
cord-002410-2zi5iv2t	236	5	strong	strong	JJ
cord-002410-2zi5iv2t	236	6	predictive	predictive	JJ
cord-002410-2zi5iv2t	236	7	value	value	NN
cord-002410-2zi5iv2t	236	8	(	(	-LRB-
cord-002410-2zi5iv2t	236	9	rs8099917	rs8099917	NN
cord-002410-2zi5iv2t	236	10	)	)	-RRB-
cord-002410-2zi5iv2t	236	11	for	for	IN
cord-002410-2zi5iv2t	236	12	the	the	DT
cord-002410-2zi5iv2t	236	13	outcome	outcome	NN
cord-002410-2zi5iv2t	236	14	of	of	IN
cord-002410-2zi5iv2t	236	15	HCV	HCV	NNP
cord-002410-2zi5iv2t	236	16	infection	infection	NN
cord-002410-2zi5iv2t	236	17	also	also	RB
cord-002410-2zi5iv2t	236	18	shows	show	VBZ
cord-002410-2zi5iv2t	236	19	a	a	DT
cord-002410-2zi5iv2t	236	20	higher	high	JJR
cord-002410-2zi5iv2t	236	21	frequency	frequency	NN
cord-002410-2zi5iv2t	236	22	of	of	IN
cord-002410-2zi5iv2t	236	23	the	the	DT
cord-002410-2zi5iv2t	236	24	protective	protective	JJ
cord-002410-2zi5iv2t	236	25	allele	allele	NN
cord-002410-2zi5iv2t	236	26	(	(	-LRB-
cord-002410-2zi5iv2t	236	27	T	T	NNP
cord-002410-2zi5iv2t	236	28	)	)	-RRB-
cord-002410-2zi5iv2t	236	29	in	in	IN
cord-002410-2zi5iv2t	236	30	individuals	individual	NNS
cord-002410-2zi5iv2t	236	31	of	of	IN
cord-002410-2zi5iv2t	236	32	European	european	JJ
cord-002410-2zi5iv2t	236	33	and	and	CC
cord-002410-2zi5iv2t	236	34	Asian	asian	JJ
cord-002410-2zi5iv2t	236	35	ancestry	ancestry	NN
cord-002410-2zi5iv2t	236	36	as	as	IN
cord-002410-2zi5iv2t	236	37	compared	compare	VBN
cord-002410-2zi5iv2t	236	38	to	to	IN
cord-002410-2zi5iv2t	236	39	individuals	individual	NNS
cord-002410-2zi5iv2t	236	40	of	of	IN
cord-002410-2zi5iv2t	236	41	African	african	JJ
cord-002410-2zi5iv2t	236	42	ancestry	ancestry	NN
cord-002410-2zi5iv2t	236	43	.	.	.
cord-002410-2zi5iv2t	237	1	In	in	IN
cord-002410-2zi5iv2t	237	2	summary	summary	NN
cord-002410-2zi5iv2t	237	3	,	,	,
cord-002410-2zi5iv2t	237	4	there	there	EX
cord-002410-2zi5iv2t	237	5	is	be	VBZ
cord-002410-2zi5iv2t	237	6	a	a	DT
cord-002410-2zi5iv2t	237	7	clear	clear	JJ
cord-002410-2zi5iv2t	237	8	link	link	NN
cord-002410-2zi5iv2t	237	9	between	between	IN
cord-002410-2zi5iv2t	237	10	IFNL	IFNL	NNP
cord-002410-2zi5iv2t	237	11	gene	gene	NN
cord-002410-2zi5iv2t	237	12	SNPs	SNPs	NNPS
cord-002410-2zi5iv2t	237	13	and	and	CC
cord-002410-2zi5iv2t	237	14	HCV	HCV	NNP
cord-002410-2zi5iv2t	237	15	treatment	treatment	NN
cord-002410-2zi5iv2t	237	16	outcome	outcome	NN
cord-002410-2zi5iv2t	237	17	as	as	RB
cord-002410-2zi5iv2t	237	18	well	well	RB
cord-002410-2zi5iv2t	237	19	as	as	IN
cord-002410-2zi5iv2t	237	20	spontaneous	spontaneous	JJ
cord-002410-2zi5iv2t	237	21	clearance	clearance	NN
cord-002410-2zi5iv2t	237	22	.	.	.
cord-002410-2zi5iv2t	238	1	Notably	notably	RB
cord-002410-2zi5iv2t	238	2	,	,	,
cord-002410-2zi5iv2t	238	3	except	except	IN
cord-002410-2zi5iv2t	238	4	for	for	IN
cord-002410-2zi5iv2t	238	5	the	the	DT
cord-002410-2zi5iv2t	238	6	SNP	SNP	NNP
cord-002410-2zi5iv2t	238	7	resulting	result	VBG
cord-002410-2zi5iv2t	238	8	in	in	IN
cord-002410-2zi5iv2t	238	9	IFNL4	ifnl4	NN
cord-002410-2zi5iv2t	238	10	expression	expression	NN
cord-002410-2zi5iv2t	238	11	,	,	,
cord-002410-2zi5iv2t	238	12	the	the	DT
cord-002410-2zi5iv2t	238	13	mechanisms	mechanism	NNS
cord-002410-2zi5iv2t	238	14	causing	cause	VBG
cord-002410-2zi5iv2t	238	15	the	the	DT
cord-002410-2zi5iv2t	238	16	association	association	NN
cord-002410-2zi5iv2t	238	17	remain	remain	VBP
cord-002410-2zi5iv2t	238	18	elusive	elusive	JJ
cord-002410-2zi5iv2t	238	19	and	and	CC
cord-002410-2zi5iv2t	238	20	the	the	DT
cord-002410-2zi5iv2t	238	21	associated	associated	JJ
cord-002410-2zi5iv2t	238	22	SNPs	SNPs	NNPS
cord-002410-2zi5iv2t	238	23	may	may	MD
cord-002410-2zi5iv2t	238	24	not	not	RB
cord-002410-2zi5iv2t	238	25	be	be	VB
cord-002410-2zi5iv2t	238	26	the	the	DT
cord-002410-2zi5iv2t	238	27	true	true	JJ
cord-002410-2zi5iv2t	238	28	causal	causal	JJ
cord-002410-2zi5iv2t	238	29	variants	variant	NNS
cord-002410-2zi5iv2t	238	30	.	.	.
cord-002410-2zi5iv2t	239	1	Nonetheless	nonetheless	RB
cord-002410-2zi5iv2t	239	2	,	,	,
cord-002410-2zi5iv2t	239	3	the	the	DT
cord-002410-2zi5iv2t	239	4	predictive	predictive	JJ
cord-002410-2zi5iv2t	239	5	value	value	NN
cord-002410-2zi5iv2t	239	6	of	of	IN
cord-002410-2zi5iv2t	239	7	the	the	DT
cord-002410-2zi5iv2t	239	8	IFNL	IFNL	NNP
cord-002410-2zi5iv2t	239	9	SNPs	SNPs	NNPS
cord-002410-2zi5iv2t	239	10	extends	extend	VBZ
cord-002410-2zi5iv2t	239	11	beyond	beyond	IN
cord-002410-2zi5iv2t	239	12	hepatitis	hepatitis	NN
cord-002410-2zi5iv2t	239	13	C	C	NNP
cord-002410-2zi5iv2t	239	14	as	as	IN
cord-002410-2zi5iv2t	239	15	genetic	genetic	JJ
cord-002410-2zi5iv2t	239	16	associations	association	NNS
cord-002410-2zi5iv2t	239	17	with	with	IN
cord-002410-2zi5iv2t	239	18	nonalcoholic	nonalcoholic	JJ
cord-002410-2zi5iv2t	239	19	fatty	fatty	JJ
cord-002410-2zi5iv2t	239	20	liver	liver	NN
cord-002410-2zi5iv2t	239	21	disease	disease	NN
cord-002410-2zi5iv2t	239	22	,	,	,
cord-002410-2zi5iv2t	239	23	allergy	allergy	NN
cord-002410-2zi5iv2t	239	24	,	,	,
cord-002410-2zi5iv2t	239	25	and	and	CC
cord-002410-2zi5iv2t	239	26	infection	infection	NN
cord-002410-2zi5iv2t	239	27	with	with	IN
cord-002410-2zi5iv2t	239	28	cytomegalovirus	cytomegalovirus	NNP
cord-002410-2zi5iv2t	239	29	,	,	,
cord-002410-2zi5iv2t	239	30	human	human	JJ
cord-002410-2zi5iv2t	239	31	T	T	NNP
cord-002410-2zi5iv2t	239	32	-	-	HYPH
cord-002410-2zi5iv2t	239	33	lymphotropic	lymphotropic	NNP
cord-002410-2zi5iv2t	239	34	virus	virus	NN
cord-002410-2zi5iv2t	239	35	,	,	,
cord-002410-2zi5iv2t	239	36	hepatitis	hepatitis	NNP
cord-002410-2zi5iv2t	239	37	B	B	NNP
cord-002410-2zi5iv2t	239	38	virus	virus	NN
cord-002410-2zi5iv2t	239	39	,	,	,
cord-002410-2zi5iv2t	239	40	HIV	HIV	NNP
cord-002410-2zi5iv2t	239	41	,	,	,
cord-002410-2zi5iv2t	239	42	and	and	CC
cord-002410-2zi5iv2t	239	43	herpes	herpes	NNP
cord-002410-2zi5iv2t	239	44	simplex	simplex	NNP
cord-002410-2zi5iv2t	239	45	virus	virus	NN
cord-002410-2zi5iv2t	239	46	have	have	VBP
cord-002410-2zi5iv2t	239	47	been	be	VBN
cord-002410-2zi5iv2t	239	48	suggested	suggest	VBN
cord-002410-2zi5iv2t	239	49	(	(	-LRB-
cord-002410-2zi5iv2t	239	50	reviewed	review	VBN
cord-002410-2zi5iv2t	239	51	in	in	IN
cord-002410-2zi5iv2t	239	52	[	[	-LRB-
cord-002410-2zi5iv2t	239	53	126	126	CD
cord-002410-2zi5iv2t	239	54	]	]	-RRB-
cord-002410-2zi5iv2t	239	55	)	)	-RRB-
cord-002410-2zi5iv2t	239	56	.	.	.
cord-002410-2zi5iv2t	240	1	The	the	DT
cord-002410-2zi5iv2t	240	2	discovery	discovery	NN
cord-002410-2zi5iv2t	240	3	of	of	IN
cord-002410-2zi5iv2t	240	4	IFNL	IFNL	NNP
cord-002410-2zi5iv2t	240	5	polymorphisms	polymorphism	NNS
cord-002410-2zi5iv2t	240	6	in	in	IN
cord-002410-2zi5iv2t	240	7	the	the	DT
cord-002410-2zi5iv2t	240	8	context	context	NN
cord-002410-2zi5iv2t	240	9	of	of	IN
cord-002410-2zi5iv2t	240	10	HCV	HCV	NNP
cord-002410-2zi5iv2t	240	11	infection	infection	NN
cord-002410-2zi5iv2t	240	12	may	may	MD
cord-002410-2zi5iv2t	240	13	therefore	therefore	RB
cord-002410-2zi5iv2t	240	14	importantly	importantly	RB
cord-002410-2zi5iv2t	240	15	contribute	contribute	VB
cord-002410-2zi5iv2t	240	16	to	to	IN
cord-002410-2zi5iv2t	240	17	the	the	DT
cord-002410-2zi5iv2t	240	18	understanding	understanding	NN
cord-002410-2zi5iv2t	240	19	of	of	IN
cord-002410-2zi5iv2t	240	20	other	other	JJ
cord-002410-2zi5iv2t	240	21	hepatic	hepatic	JJ
cord-002410-2zi5iv2t	240	22	and	and	CC
cord-002410-2zi5iv2t	240	23	extrahepatic	extrahepatic	JJ
cord-002410-2zi5iv2t	240	24	diseases	disease	NNS
cord-002410-2zi5iv2t	240	25	.	.	.
cord-002410-2zi5iv2t	241	1	Before	before	IN
cord-002410-2zi5iv2t	241	2	the	the	DT
cord-002410-2zi5iv2t	241	3	rise	rise	NN
cord-002410-2zi5iv2t	241	4	of	of	IN
cord-002410-2zi5iv2t	241	5	DAAs	daas	NN
cord-002410-2zi5iv2t	241	6	targeting	target	VBG
cord-002410-2zi5iv2t	241	7	HCV	HCV	NNP
cord-002410-2zi5iv2t	241	8	,	,	,
cord-002410-2zi5iv2t	241	9	IFNLs	IFNLs	NNP
cord-002410-2zi5iv2t	241	10	were	be	VBD
cord-002410-2zi5iv2t	241	11	considered	consider	VBN
cord-002410-2zi5iv2t	241	12	an	an	DT
cord-002410-2zi5iv2t	241	13	attractive	attractive	JJ
cord-002410-2zi5iv2t	241	14	alternative	alternative	NN
cord-002410-2zi5iv2t	241	15	to	to	IN
cord-002410-2zi5iv2t	241	16	IFNalpha	ifnalpha	NN
cord-002410-2zi5iv2t	241	17	/	/	SYM
cord-002410-2zi5iv2t	241	18	RBV	RBV	NNP
cord-002410-2zi5iv2t	241	19	treatment	treatment	NN
cord-002410-2zi5iv2t	241	20	for	for	IN
cord-002410-2zi5iv2t	241	21	several	several	JJ
cord-002410-2zi5iv2t	241	22	reasons	reason	NNS
cord-002410-2zi5iv2t	241	23	.	.	.
cord-002410-2zi5iv2t	242	1	The	the	DT
cord-002410-2zi5iv2t	242	2	antiviral	antiviral	JJ
cord-002410-2zi5iv2t	242	3	profile	profile	NN
cord-002410-2zi5iv2t	242	4	of	of	IN
cord-002410-2zi5iv2t	242	5	IFNL	IFNL	NNP
cord-002410-2zi5iv2t	242	6	resembles	resemble	VBZ
cord-002410-2zi5iv2t	242	7	the	the	DT
cord-002410-2zi5iv2t	242	8	one	one	CD
cord-002410-2zi5iv2t	242	9	of	of	IN
cord-002410-2zi5iv2t	242	10	IFN	IFN	NNP
cord-002410-2zi5iv2t	242	11	-	-	HYPH
cord-002410-2zi5iv2t	242	12	alpha	alpha	NN
cord-002410-2zi5iv2t	242	13	,	,	,
cord-002410-2zi5iv2t	242	14	as	as	IN
cord-002410-2zi5iv2t	242	15	both	both	DT
cord-002410-2zi5iv2t	242	16	interferons	interferon	NNS
cord-002410-2zi5iv2t	242	17	signal	signal	VBP
cord-002410-2zi5iv2t	242	18	via	via	IN
cord-002410-2zi5iv2t	242	19	ISGF3	isgf3	PRP
cord-002410-2zi5iv2t	242	20	.	.	.
cord-002410-2zi5iv2t	243	1	This	this	DT
cord-002410-2zi5iv2t	243	2	holds	hold	VBZ
cord-002410-2zi5iv2t	243	3	true	true	JJ
cord-002410-2zi5iv2t	243	4	in	in	IN
cord-002410-2zi5iv2t	243	5	primary	primary	JJ
cord-002410-2zi5iv2t	243	6	human	human	JJ
cord-002410-2zi5iv2t	243	7	hepatocytes	hepatocyte	NNS
cord-002410-2zi5iv2t	243	8	[	[	-LRB-
cord-002410-2zi5iv2t	243	9	105	105	CD
cord-002410-2zi5iv2t	243	10	]	]	-RRB-
cord-002410-2zi5iv2t	243	11	as	as	RB
cord-002410-2zi5iv2t	243	12	well	well	RB
cord-002410-2zi5iv2t	243	13	as	as	IN
cord-002410-2zi5iv2t	243	14	in	in	IN
cord-002410-2zi5iv2t	243	15	hepatoma	hepatoma	NNP
cord-002410-2zi5iv2t	243	16	cell	cell	NN
cord-002410-2zi5iv2t	243	17	lines	line	NNS
cord-002410-2zi5iv2t	243	18	[	[	-LRB-
cord-002410-2zi5iv2t	243	19	49	49	CD
cord-002410-2zi5iv2t	243	20	]	]	-RRB-
cord-002410-2zi5iv2t	243	21	.	.	.
cord-002410-2zi5iv2t	244	1	However	however	RB
cord-002410-2zi5iv2t	244	2	the	the	DT
cord-002410-2zi5iv2t	244	3	kinetics	kinetic	NNS
cord-002410-2zi5iv2t	244	4	and	and	CC
cord-002410-2zi5iv2t	244	5	magnitude	magnitude	NN
cord-002410-2zi5iv2t	244	6	of	of	IN
cord-002410-2zi5iv2t	244	7	ISG	ISG	NNP
cord-002410-2zi5iv2t	244	8	induction	induction	NN
cord-002410-2zi5iv2t	244	9	differ	differ	VBP
cord-002410-2zi5iv2t	244	10	between	between	IN
cord-002410-2zi5iv2t	244	11	IFNalpha	IFNalpha	NNS
cord-002410-2zi5iv2t	244	12	and	and	CC
cord-002410-2zi5iv2t	244	13	IFNL	IFNL	NNP
cord-002410-2zi5iv2t	244	14	[	[	-LRB-
cord-002410-2zi5iv2t	244	15	55	55	CD
cord-002410-2zi5iv2t	244	16	,	,	,
cord-002410-2zi5iv2t	244	17	103	103	CD
cord-002410-2zi5iv2t	244	18	,	,	,
cord-002410-2zi5iv2t	244	19	127	127	CD
cord-002410-2zi5iv2t	244	20	]	]	-RRB-
cord-002410-2zi5iv2t	244	21	.	.	.
cord-002410-2zi5iv2t	245	1	Another	another	DT
cord-002410-2zi5iv2t	245	2	difference	difference	NN
cord-002410-2zi5iv2t	245	3	between	between	IN
cord-002410-2zi5iv2t	245	4	the	the	DT
cord-002410-2zi5iv2t	245	5	two	two	CD
cord-002410-2zi5iv2t	245	6	IFN	IFN	NNP
cord-002410-2zi5iv2t	245	7	types	type	NNS
cord-002410-2zi5iv2t	245	8	is	be	VBZ
cord-002410-2zi5iv2t	245	9	their	-PRON-	PRP$
cord-002410-2zi5iv2t	245	10	tissue	tissue	NN
cord-002410-2zi5iv2t	245	11	specificity	specificity	NN
cord-002410-2zi5iv2t	245	12	caused	cause	VBN
cord-002410-2zi5iv2t	245	13	by	by	IN
cord-002410-2zi5iv2t	245	14	the	the	DT
cord-002410-2zi5iv2t	245	15	divergent	divergent	JJ
cord-002410-2zi5iv2t	245	16	expression	expression	NN
cord-002410-2zi5iv2t	245	17	pattern	pattern	NN
cord-002410-2zi5iv2t	245	18	of	of	IN
cord-002410-2zi5iv2t	245	19	their	-PRON-	PRP$
cord-002410-2zi5iv2t	245	20	receptors	receptor	NNS
cord-002410-2zi5iv2t	245	21	;	;	:
cord-002410-2zi5iv2t	245	22	in	in	IN
cord-002410-2zi5iv2t	245	23	contrast	contrast	NN
cord-002410-2zi5iv2t	245	24	to	to	IN
cord-002410-2zi5iv2t	245	25	the	the	DT
cord-002410-2zi5iv2t	245	26	IFNL	IFNL	NNP
cord-002410-2zi5iv2t	245	27	receptor	receptor	NN
cord-002410-2zi5iv2t	245	28	complex	complex	NN
cord-002410-2zi5iv2t	245	29	,	,	,
cord-002410-2zi5iv2t	245	30	which	which	WDT
cord-002410-2zi5iv2t	245	31	shows	show	VBZ
cord-002410-2zi5iv2t	245	32	a	a	DT
cord-002410-2zi5iv2t	245	33	restricted	restricted	JJ
cord-002410-2zi5iv2t	245	34	tissue	tissue	NN
cord-002410-2zi5iv2t	245	35	expression	expression	NN
cord-002410-2zi5iv2t	245	36	,	,	,
cord-002410-2zi5iv2t	245	37	the	the	DT
cord-002410-2zi5iv2t	245	38	IFN	IFN	NNP
cord-002410-2zi5iv2t	245	39	-	-	HYPH
cord-002410-2zi5iv2t	245	40	alpha	alpha	NN
cord-002410-2zi5iv2t	245	41	receptor	receptor	NN
cord-002410-2zi5iv2t	245	42	is	be	VBZ
cord-002410-2zi5iv2t	245	43	expressed	express	VBN
cord-002410-2zi5iv2t	245	44	ubiquitously	ubiquitously	RB
cord-002410-2zi5iv2t	245	45	.	.	.
cord-002410-2zi5iv2t	246	1	Thus	thus	RB
cord-002410-2zi5iv2t	246	2	compared	compare	VBN
cord-002410-2zi5iv2t	246	3	to	to	IN
cord-002410-2zi5iv2t	246	4	IFNL	IFNL	NNP
cord-002410-2zi5iv2t	246	5	,	,	,
cord-002410-2zi5iv2t	246	6	IFN	IFN	NNP
cord-002410-2zi5iv2t	246	7	-	-	HYPH
cord-002410-2zi5iv2t	246	8	alpha	alpha	NN
cord-002410-2zi5iv2t	246	9	acts	act	VBZ
cord-002410-2zi5iv2t	246	10	more	more	RBR
cord-002410-2zi5iv2t	246	11	systemic	systemic	JJ
cord-002410-2zi5iv2t	246	12	,	,	,
cord-002410-2zi5iv2t	246	13	causing	cause	VBG
cord-002410-2zi5iv2t	246	14	more	more	RBR
cord-002410-2zi5iv2t	246	15	adverse	adverse	JJ
cord-002410-2zi5iv2t	246	16	effects	effect	NNS
cord-002410-2zi5iv2t	246	17	,	,	,
cord-002410-2zi5iv2t	246	18	which	which	WDT
cord-002410-2zi5iv2t	246	19	are	be	VBP
cord-002410-2zi5iv2t	246	20	often	often	RB
cord-002410-2zi5iv2t	246	21	limiting	limit	VBG
cord-002410-2zi5iv2t	246	22	treatment	treatment	NN
cord-002410-2zi5iv2t	246	23	options	option	NNS
cord-002410-2zi5iv2t	246	24	and	and	CC
cord-002410-2zi5iv2t	246	25	compliance	compliance	NN
cord-002410-2zi5iv2t	246	26	.	.	.
cord-002410-2zi5iv2t	247	1	The	the	DT
cord-002410-2zi5iv2t	247	2	overlapping	overlap	VBG
cord-002410-2zi5iv2t	247	3	response	response	NN
cord-002410-2zi5iv2t	247	4	of	of	IN
cord-002410-2zi5iv2t	247	5	IFN	IFN	NNP
cord-002410-2zi5iv2t	247	6	-	-	HYPH
cord-002410-2zi5iv2t	247	7	alpha	alpha	NNP
cord-002410-2zi5iv2t	247	8	and	and	CC
cord-002410-2zi5iv2t	247	9	IFNL	IFNL	NNP
cord-002410-2zi5iv2t	247	10	signaling	signal	VBG
cord-002410-2zi5iv2t	247	11	on	on	IN
cord-002410-2zi5iv2t	247	12	the	the	DT
cord-002410-2zi5iv2t	247	13	one	one	CD
cord-002410-2zi5iv2t	247	14	hand	hand	NN
cord-002410-2zi5iv2t	247	15	and	and	CC
cord-002410-2zi5iv2t	247	16	the	the	DT
cord-002410-2zi5iv2t	247	17	tissue	tissue	NN
cord-002410-2zi5iv2t	247	18	specificity	specificity	NN
cord-002410-2zi5iv2t	247	19	of	of	IN
cord-002410-2zi5iv2t	247	20	the	the	DT
cord-002410-2zi5iv2t	247	21	IFNLR	IFNLR	NNP
cord-002410-2zi5iv2t	247	22	on	on	IN
cord-002410-2zi5iv2t	247	23	the	the	DT
cord-002410-2zi5iv2t	247	24	other	other	JJ
cord-002410-2zi5iv2t	247	25	hand	hand	NN
cord-002410-2zi5iv2t	247	26	made	make	VBD
cord-002410-2zi5iv2t	247	27	IFNL	IFNL	NNP
cord-002410-2zi5iv2t	247	28	promise	promise	NN
cord-002410-2zi5iv2t	247	29	that	that	IN
cord-002410-2zi5iv2t	247	30	the	the	DT
cord-002410-2zi5iv2t	247	31	replacement	replacement	NN
cord-002410-2zi5iv2t	247	32	of	of	IN
cord-002410-2zi5iv2t	247	33	IFN	IFN	NNP
cord-002410-2zi5iv2t	247	34	-	-	HYPH
cord-002410-2zi5iv2t	247	35	alpha	alpha	NN
cord-002410-2zi5iv2t	247	36	by	by	IN
cord-002410-2zi5iv2t	247	37	IFNL	IFNL	NNP
cord-002410-2zi5iv2t	247	38	would	would	MD
cord-002410-2zi5iv2t	247	39	yield	yield	VB
cord-002410-2zi5iv2t	247	40	the	the	DT
cord-002410-2zi5iv2t	247	41	same	same	JJ
cord-002410-2zi5iv2t	247	42	therapy	therapy	NN
cord-002410-2zi5iv2t	247	43	outcome	outcome	NN
cord-002410-2zi5iv2t	247	44	with	with	IN
cord-002410-2zi5iv2t	247	45	fewer	few	JJR
cord-002410-2zi5iv2t	247	46	side	side	NN
cord-002410-2zi5iv2t	247	47	effects	effect	NNS
cord-002410-2zi5iv2t	247	48	.	.	.
cord-002410-2zi5iv2t	248	1	Indeed	indeed	RB
cord-002410-2zi5iv2t	248	2	,	,	,
cord-002410-2zi5iv2t	248	3	clinical	clinical	JJ
cord-002410-2zi5iv2t	248	4	studies	study	NNS
cord-002410-2zi5iv2t	248	5	revealed	reveal	VBD
cord-002410-2zi5iv2t	248	6	an	an	DT
cord-002410-2zi5iv2t	248	7	improved	improved	JJ
cord-002410-2zi5iv2t	248	8	safety	safety	NN
cord-002410-2zi5iv2t	248	9	and	and	CC
cord-002410-2zi5iv2t	248	10	tolerability	tolerability	NN
cord-002410-2zi5iv2t	248	11	profile	profile	NN
cord-002410-2zi5iv2t	248	12	for	for	IN
cord-002410-2zi5iv2t	248	13	PEG	peg	NN
cord-002410-2zi5iv2t	248	14	-	-	HYPH
cord-002410-2zi5iv2t	248	15	IFNL1a	ifnl1a	NN
cord-002410-2zi5iv2t	248	16	compared	compare	VBN
cord-002410-2zi5iv2t	248	17	to	to	IN
cord-002410-2zi5iv2t	248	18	PEG	peg	NN
cord-002410-2zi5iv2t	248	19	-	-	HYPH
cord-002410-2zi5iv2t	248	20	IFNalpha	IFNalpha	NNP
cord-002410-2zi5iv2t	248	21	[	[	-LRB-
cord-002410-2zi5iv2t	248	22	128	128	CD
cord-002410-2zi5iv2t	248	23	,	,	,
cord-002410-2zi5iv2t	248	24	129	129	CD
cord-002410-2zi5iv2t	248	25	]	]	-RRB-
cord-002410-2zi5iv2t	248	26	.	.	.
cord-002410-2zi5iv2t	249	1	When	when	WRB
cord-002410-2zi5iv2t	249	2	used	use	VBN
cord-002410-2zi5iv2t	249	3	in	in	IN
cord-002410-2zi5iv2t	249	4	combination	combination	NN
cord-002410-2zi5iv2t	249	5	with	with	IN
cord-002410-2zi5iv2t	249	6	RBV	RBV	NNP
cord-002410-2zi5iv2t	249	7	and	and	CC
cord-002410-2zi5iv2t	249	8	the	the	DT
cord-002410-2zi5iv2t	249	9	DAA	DAA	NNP
cord-002410-2zi5iv2t	249	10	Daclatasvir	Daclatasvir	NNP
cord-002410-2zi5iv2t	249	11	,	,	,
cord-002410-2zi5iv2t	249	12	a	a	DT
cord-002410-2zi5iv2t	249	13	24-week	24-week	JJ
cord-002410-2zi5iv2t	249	14	PEG	peg	NN
cord-002410-2zi5iv2t	249	15	-	-	HYPH
cord-002410-2zi5iv2t	249	16	IFNL1a	ifnl1a	JJ
cord-002410-2zi5iv2t	249	17	based	base	VBN
cord-002410-2zi5iv2t	249	18	treatment	treatment	NN
cord-002410-2zi5iv2t	249	19	does	do	VBZ
cord-002410-2zi5iv2t	249	20	not	not	RB
cord-002410-2zi5iv2t	249	21	only	only	RB
cord-002410-2zi5iv2t	249	22	show	show	VB
cord-002410-2zi5iv2t	249	23	less	less	RBR
cord-002410-2zi5iv2t	249	24	adverse	adverse	JJ
cord-002410-2zi5iv2t	249	25	events	event	NNS
cord-002410-2zi5iv2t	249	26	,	,	,
cord-002410-2zi5iv2t	249	27	but	but	CC
cord-002410-2zi5iv2t	249	28	also	also	RB
cord-002410-2zi5iv2t	249	29	leads	lead	VBZ
cord-002410-2zi5iv2t	249	30	to	to	IN
cord-002410-2zi5iv2t	249	31	a	a	DT
cord-002410-2zi5iv2t	249	32	higher	higher	RBR
cord-002410-2zi5iv2t	249	33	sustained	sustained	JJ
cord-002410-2zi5iv2t	249	34	virological	virological	JJ
cord-002410-2zi5iv2t	249	35	response	response	NN
cord-002410-2zi5iv2t	249	36	than	than	IN
cord-002410-2zi5iv2t	249	37	treatment	treatment	NN
cord-002410-2zi5iv2t	249	38	with	with	IN
cord-002410-2zi5iv2t	249	39	a	a	DT
cord-002410-2zi5iv2t	249	40	PEG	PEG	NNP
cord-002410-2zi5iv2t	249	41	-	-	HYPH
cord-002410-2zi5iv2t	249	42	IFN	IFN	NNP
cord-002410-2zi5iv2t	249	43	-	-	HYPH
cord-002410-2zi5iv2t	249	44	alpha	alpha	NN
cord-002410-2zi5iv2t	249	45	based	base	VBN
cord-002410-2zi5iv2t	249	46	regime	regime	NN
cord-002410-2zi5iv2t	249	47	;	;	:
cord-002410-2zi5iv2t	249	48	12	12	CD
cord-002410-2zi5iv2t	249	49	weeks	week	NNS
cord-002410-2zi5iv2t	249	50	after	after	IN
cord-002410-2zi5iv2t	249	51	treatment	treatment	NN
cord-002410-2zi5iv2t	249	52	no	no	DT
cord-002410-2zi5iv2t	249	53	HCV	HCV	NNP
cord-002410-2zi5iv2t	249	54	RNA	RNA	NNP
cord-002410-2zi5iv2t	249	55	is	be	VBZ
cord-002410-2zi5iv2t	249	56	detectable	detectable	JJ
cord-002410-2zi5iv2t	249	57	in	in	IN
cord-002410-2zi5iv2t	249	58	the	the	DT
cord-002410-2zi5iv2t	249	59	blood	blood	NN
cord-002410-2zi5iv2t	249	60	of	of	IN
cord-002410-2zi5iv2t	249	61	88	88	CD
cord-002410-2zi5iv2t	249	62	%	%	NN
cord-002410-2zi5iv2t	249	63	of	of	IN
cord-002410-2zi5iv2t	249	64	patients	patient	NNS
cord-002410-2zi5iv2t	249	65	in	in	IN
cord-002410-2zi5iv2t	249	66	the	the	DT
cord-002410-2zi5iv2t	249	67	PEG	peg	NN
cord-002410-2zi5iv2t	249	68	-	-	HYPH
cord-002410-2zi5iv2t	249	69	IFNL1a	ifnl1a	JJ
cord-002410-2zi5iv2t	249	70	group	group	NN
cord-002410-2zi5iv2t	249	71	compared	compare	VBN
cord-002410-2zi5iv2t	249	72	to	to	IN
cord-002410-2zi5iv2t	249	73	only	only	RB
cord-002410-2zi5iv2t	249	74	70.5	70.5	CD
cord-002410-2zi5iv2t	249	75	%	%	NN
cord-002410-2zi5iv2t	249	76	of	of	IN
cord-002410-2zi5iv2t	249	77	patients	patient	NNS
cord-002410-2zi5iv2t	249	78	in	in	IN
cord-002410-2zi5iv2t	249	79	the	the	DT
cord-002410-2zi5iv2t	249	80	PEG	peg	NN
cord-002410-2zi5iv2t	249	81	-	-	HYPH
cord-002410-2zi5iv2t	249	82	IFNL1a	ifnl1a	JJ
cord-002410-2zi5iv2t	249	83	group	group	NN
cord-002410-2zi5iv2t	249	84	[	[	-LRB-
cord-002410-2zi5iv2t	249	85	130	130	CD
cord-002410-2zi5iv2t	249	86	]	]	-RRB-
cord-002410-2zi5iv2t	249	87	.	.	.
cord-002410-2zi5iv2t	250	1	In	in	IN
cord-002410-2zi5iv2t	250	2	a	a	DT
cord-002410-2zi5iv2t	250	3	different	different	JJ
cord-002410-2zi5iv2t	250	4	clinical	clinical	JJ
cord-002410-2zi5iv2t	250	5	study	study	NN
cord-002410-2zi5iv2t	250	6	PEG	peg	NN
cord-002410-2zi5iv2t	250	7	-	-	:
cord-002410-2zi5iv2t	250	8	IFNL1a	ifnl1a	NN
cord-002410-2zi5iv2t	250	9	or	or	CC
cord-002410-2zi5iv2t	250	10	PEG	peg	NN
cord-002410-2zi5iv2t	250	11	-	-	HYPH
cord-002410-2zi5iv2t	250	12	IFN	IFN	NNP
cord-002410-2zi5iv2t	250	13	-	-	HYPH
cord-002410-2zi5iv2t	250	14	alpha2a	alpha2a	NNP
cord-002410-2zi5iv2t	250	15	were	be	VBD
cord-002410-2zi5iv2t	250	16	given	give	VBN
cord-002410-2zi5iv2t	250	17	together	together	RB
cord-002410-2zi5iv2t	250	18	with	with	IN
cord-002410-2zi5iv2t	250	19	RBV	RBV	NNP
cord-002410-2zi5iv2t	250	20	and	and	CC
cord-002410-2zi5iv2t	250	21	Telaprevir	Telaprevir	NNP
cord-002410-2zi5iv2t	250	22	,	,	,
cord-002410-2zi5iv2t	250	23	but	but	CC
cord-002410-2zi5iv2t	250	24	here	here	RB
cord-002410-2zi5iv2t	250	25	no	no	DT
cord-002410-2zi5iv2t	250	26	noninferiority	noninferiority	NN
cord-002410-2zi5iv2t	250	27	of	of	IN
cord-002410-2zi5iv2t	250	28	PEG	peg	NN
cord-002410-2zi5iv2t	250	29	-	-	:
cord-002410-2zi5iv2t	250	30	IFNL1a	ifnl1a	JJ
cord-002410-2zi5iv2t	250	31	regarding	regard	VBG
cord-002410-2zi5iv2t	250	32	safety	safety	NN
cord-002410-2zi5iv2t	250	33	,	,	,
cord-002410-2zi5iv2t	250	34	tolerability	tolerability	NN
cord-002410-2zi5iv2t	250	35	,	,	,
cord-002410-2zi5iv2t	250	36	and	and	CC
cord-002410-2zi5iv2t	250	37	efficacy	efficacy	NN
cord-002410-2zi5iv2t	250	38	was	be	VBD
cord-002410-2zi5iv2t	250	39	observed	observe	VBN
cord-002410-2zi5iv2t	250	40	[	[	-LRB-
cord-002410-2zi5iv2t	250	41	131	131	CD
cord-002410-2zi5iv2t	250	42	]	]	-RRB-
cord-002410-2zi5iv2t	250	43	.	.	.
cord-002410-2zi5iv2t	251	1	IFNL3	IFNL3	NNP
cord-002410-2zi5iv2t	251	2	has	have	VBZ
cord-002410-2zi5iv2t	251	3	the	the	DT
cord-002410-2zi5iv2t	251	4	highest	high	JJS
cord-002410-2zi5iv2t	251	5	activity	activity	NN
cord-002410-2zi5iv2t	251	6	among	among	IN
cord-002410-2zi5iv2t	251	7	the	the	DT
cord-002410-2zi5iv2t	251	8	IFNL	IFNL	NNP
cord-002410-2zi5iv2t	251	9	types	type	NNS
cord-002410-2zi5iv2t	251	10	and	and	CC
cord-002410-2zi5iv2t	251	11	therefore	therefore	RB
cord-002410-2zi5iv2t	251	12	might	may	MD
cord-002410-2zi5iv2t	251	13	be	be	VB
cord-002410-2zi5iv2t	251	14	more	more	RBR
cord-002410-2zi5iv2t	251	15	suitable	suitable	JJ
cord-002410-2zi5iv2t	251	16	as	as	IN
cord-002410-2zi5iv2t	251	17	therapeutic	therapeutic	JJ
cord-002410-2zi5iv2t	251	18	agent	agent	NN
cord-002410-2zi5iv2t	251	19	than	than	IN
cord-002410-2zi5iv2t	251	20	IFNL1	IFNL1	NNP
cord-002410-2zi5iv2t	252	1	[	[	-LRB-
cord-002410-2zi5iv2t	252	2	55	55	CD
cord-002410-2zi5iv2t	252	3	]	]	-RRB-
cord-002410-2zi5iv2t	252	4	.	.	.
cord-002410-2zi5iv2t	253	1	Nevertheless	nevertheless	RB
cord-002410-2zi5iv2t	253	2	,	,	,
cord-002410-2zi5iv2t	253	3	only	only	RB
cord-002410-2zi5iv2t	253	4	IFNL1	ifnl1	PRP
cord-002410-2zi5iv2t	253	5	has	have	VBZ
cord-002410-2zi5iv2t	253	6	been	be	VBN
cord-002410-2zi5iv2t	253	7	evaluated	evaluate	VBN
cord-002410-2zi5iv2t	253	8	in	in	IN
cord-002410-2zi5iv2t	253	9	clinical	clinical	JJ
cord-002410-2zi5iv2t	253	10	trials	trial	NNS
cord-002410-2zi5iv2t	253	11	so	so	RB
cord-002410-2zi5iv2t	253	12	far	far	RB
cord-002410-2zi5iv2t	253	13	,	,	,
cord-002410-2zi5iv2t	253	14	probably	probably	RB
cord-002410-2zi5iv2t	253	15	due	due	IN
cord-002410-2zi5iv2t	253	16	to	to	IN
cord-002410-2zi5iv2t	253	17	the	the	DT
cord-002410-2zi5iv2t	253	18	fact	fact	NN
cord-002410-2zi5iv2t	253	19	that	that	IN
cord-002410-2zi5iv2t	253	20	recombinant	recombinant	JJ
cord-002410-2zi5iv2t	253	21	IFNL3	IFNL3	NNS
cord-002410-2zi5iv2t	253	22	is	be	VBZ
cord-002410-2zi5iv2t	253	23	difficult	difficult	JJ
cord-002410-2zi5iv2t	253	24	to	to	TO
cord-002410-2zi5iv2t	253	25	produce	produce	VB
cord-002410-2zi5iv2t	253	26	.	.	.
cord-002410-2zi5iv2t	254	1	Recently	recently	RB
cord-002410-2zi5iv2t	254	2	IFNL3	IFNL3	NNP
cord-002410-2zi5iv2t	254	3	analogs	analog	NNS
cord-002410-2zi5iv2t	254	4	,	,	,
cord-002410-2zi5iv2t	254	5	which	which	WDT
cord-002410-2zi5iv2t	254	6	allow	allow	VBP
cord-002410-2zi5iv2t	254	7	high	high	JJ
cord-002410-2zi5iv2t	254	8	yield	yield	NN
cord-002410-2zi5iv2t	254	9	production	production	NN
cord-002410-2zi5iv2t	254	10	and	and	CC
cord-002410-2zi5iv2t	254	11	are	be	VBP
cord-002410-2zi5iv2t	254	12	comparable	comparable	JJ
cord-002410-2zi5iv2t	254	13	to	to	IN
cord-002410-2zi5iv2t	254	14	IFN	IFN	NNP
cord-002410-2zi5iv2t	254	15	-	-	HYPH
cord-002410-2zi5iv2t	254	16	alpha2a	alpha2a	NNP
cord-002410-2zi5iv2t	254	17	in	in	IN
cord-002410-2zi5iv2t	254	18	their	-PRON-	PRP$
cord-002410-2zi5iv2t	254	19	ability	ability	NN
cord-002410-2zi5iv2t	254	20	to	to	TO
cord-002410-2zi5iv2t	254	21	inhibit	inhibit	VB
cord-002410-2zi5iv2t	254	22	HCV	HCV	NNP
cord-002410-2zi5iv2t	254	23	replication	replication	NN
cord-002410-2zi5iv2t	254	24	in	in	IN
cord-002410-2zi5iv2t	254	25	Huh-7.5.1	Huh-7.5.1	NNP
cord-002410-2zi5iv2t	254	26	cells	cell	NNS
cord-002410-2zi5iv2t	254	27	,	,	,
cord-002410-2zi5iv2t	254	28	have	have	VBP
cord-002410-2zi5iv2t	254	29	been	be	VBN
cord-002410-2zi5iv2t	254	30	designed	design	VBN
cord-002410-2zi5iv2t	254	31	[	[	-LRB-
cord-002410-2zi5iv2t	254	32	132	132	CD
cord-002410-2zi5iv2t	254	33	]	]	-RRB-
cord-002410-2zi5iv2t	254	34	.	.	.
cord-002410-2zi5iv2t	255	1	However	however	RB
cord-002410-2zi5iv2t	255	2	,	,	,
cord-002410-2zi5iv2t	255	3	the	the	DT
cord-002410-2zi5iv2t	255	4	licensing	licensing	NN
cord-002410-2zi5iv2t	255	5	of	of	IN
cord-002410-2zi5iv2t	255	6	effective	effective	JJ
cord-002410-2zi5iv2t	255	7	DAA	DAA	NNP
cord-002410-2zi5iv2t	255	8	paved	pave	VBD
cord-002410-2zi5iv2t	255	9	the	the	DT
cord-002410-2zi5iv2t	255	10	way	way	NN
cord-002410-2zi5iv2t	255	11	for	for	IN
cord-002410-2zi5iv2t	255	12	an	an	DT
cord-002410-2zi5iv2t	255	13	IFN	IFN	NNP
cord-002410-2zi5iv2t	255	14	-	-	HYPH
cord-002410-2zi5iv2t	255	15	free	free	JJ
cord-002410-2zi5iv2t	255	16	therapy	therapy	NN
cord-002410-2zi5iv2t	255	17	of	of	IN
cord-002410-2zi5iv2t	255	18	CHC	CHC	NNP
cord-002410-2zi5iv2t	255	19	,	,	,
cord-002410-2zi5iv2t	255	20	which	which	WDT
cord-002410-2zi5iv2t	255	21	is	be	VBZ
cord-002410-2zi5iv2t	255	22	becoming	become	VBG
cord-002410-2zi5iv2t	255	23	the	the	DT
cord-002410-2zi5iv2t	255	24	standard	standard	NN
cord-002410-2zi5iv2t	255	25	of	of	IN
cord-002410-2zi5iv2t	255	26	care	care	NN
cord-002410-2zi5iv2t	255	27	nowadays	nowadays	RB
cord-002410-2zi5iv2t	255	28	.	.	.
cord-002410-2zi5iv2t	256	1	Thus	thus	RB
cord-002410-2zi5iv2t	256	2	most	most	RBS
cord-002410-2zi5iv2t	256	3	likely	likely	JJ
cord-002410-2zi5iv2t	256	4	IFNL	IFNL	NNP
cord-002410-2zi5iv2t	256	5	will	will	MD
cord-002410-2zi5iv2t	256	6	not	not	RB
cord-002410-2zi5iv2t	256	7	be	be	VB
cord-002410-2zi5iv2t	256	8	needed	need	VBN
cord-002410-2zi5iv2t	256	9	as	as	IN
cord-002410-2zi5iv2t	256	10	therapeutic	therapeutic	JJ
cord-002410-2zi5iv2t	256	11	agent	agent	NN
cord-002410-2zi5iv2t	256	12	for	for	IN
cord-002410-2zi5iv2t	256	13	hepatitis	hepatitis	NNP
cord-002410-2zi5iv2t	256	14	C	C	NNP
cord-002410-2zi5iv2t	256	15	in	in	IN
cord-002410-2zi5iv2t	256	16	the	the	DT
cord-002410-2zi5iv2t	256	17	future	future	NN
cord-002410-2zi5iv2t	256	18	.	.	.
cord-002410-2zi5iv2t	257	1	While	while	IN
cord-002410-2zi5iv2t	257	2	the	the	DT
cord-002410-2zi5iv2t	257	3	development	development	NN
cord-002410-2zi5iv2t	257	4	of	of	IN
cord-002410-2zi5iv2t	257	5	hepatitis	hepatitis	NN
cord-002410-2zi5iv2t	257	6	C	C	NNP
cord-002410-2zi5iv2t	257	7	drugs	drug	NNS
cord-002410-2zi5iv2t	257	8	is	be	VBZ
cord-002410-2zi5iv2t	257	9	fortunately	fortunately	RB
cord-002410-2zi5iv2t	257	10	an	an	DT
cord-002410-2zi5iv2t	257	11	unprecedented	unprecedented	JJ
cord-002410-2zi5iv2t	257	12	success	success	NN
cord-002410-2zi5iv2t	257	13	story	story	NN
cord-002410-2zi5iv2t	257	14	[	[	-LRB-
cord-002410-2zi5iv2t	257	15	133	133	CD
cord-002410-2zi5iv2t	257	16	]	]	-RRB-
cord-002410-2zi5iv2t	257	17	,	,	,
cord-002410-2zi5iv2t	257	18	we	-PRON-	PRP
cord-002410-2zi5iv2t	257	19	still	still	RB
cord-002410-2zi5iv2t	257	20	lack	lack	VBP
cord-002410-2zi5iv2t	257	21	specific	specific	JJ
cord-002410-2zi5iv2t	257	22	drugs	drug	NNS
cord-002410-2zi5iv2t	257	23	for	for	IN
cord-002410-2zi5iv2t	257	24	other	other	JJ
cord-002410-2zi5iv2t	257	25	hepatotropic	hepatotropic	NNP
cord-002410-2zi5iv2t	257	26	viruses	virus	NNS
cord-002410-2zi5iv2t	257	27	.	.	.
cord-002410-2zi5iv2t	258	1	For	for	IN
cord-002410-2zi5iv2t	258	2	instance	instance	NN
cord-002410-2zi5iv2t	258	3	,	,	,
cord-002410-2zi5iv2t	258	4	hepatitis	hepatitis	NN
cord-002410-2zi5iv2t	258	5	E	e	NN
cord-002410-2zi5iv2t	258	6	virus	virus	NN
cord-002410-2zi5iv2t	258	7	is	be	VBZ
cord-002410-2zi5iv2t	258	8	sensitive	sensitive	JJ
cord-002410-2zi5iv2t	258	9	to	to	IN
cord-002410-2zi5iv2t	258	10	IFNL	IFNL	NNP
cord-002410-2zi5iv2t	258	11	in	in	IN
cord-002410-2zi5iv2t	258	12	in	in	IN
cord-002410-2zi5iv2t	258	13	vitro	vitro	FW
cord-002410-2zi5iv2t	258	14	models	model	NNS
cord-002410-2zi5iv2t	258	15	[	[	-LRB-
cord-002410-2zi5iv2t	258	16	134	134	CD
cord-002410-2zi5iv2t	258	17	]	]	-RRB-
cord-002410-2zi5iv2t	258	18	and	and	CC
cord-002410-2zi5iv2t	258	19	currently	currently	RB
cord-002410-2zi5iv2t	258	20	treatment	treatment	NN
cord-002410-2zi5iv2t	258	21	options	option	NNS
cord-002410-2zi5iv2t	258	22	for	for	IN
cord-002410-2zi5iv2t	258	23	hepatitis	hepatitis	NN
cord-002410-2zi5iv2t	258	24	E	E	NNP
cord-002410-2zi5iv2t	258	25	are	be	VBP
cord-002410-2zi5iv2t	258	26	limited	limited	JJ
cord-002410-2zi5iv2t	258	27	.	.	.
cord-002410-2zi5iv2t	259	1	Consequently	consequently	RB
cord-002410-2zi5iv2t	259	2	,	,	,
cord-002410-2zi5iv2t	259	3	the	the	DT
cord-002410-2zi5iv2t	259	4	mechanistic	mechanistic	JJ
cord-002410-2zi5iv2t	259	5	insights	insight	NNS
cord-002410-2zi5iv2t	259	6	on	on	IN
cord-002410-2zi5iv2t	259	7	the	the	DT
cord-002410-2zi5iv2t	259	8	interplay	interplay	NN
cord-002410-2zi5iv2t	259	9	of	of	IN
cord-002410-2zi5iv2t	259	10	IFNL	IFNL	NNP
cord-002410-2zi5iv2t	259	11	and	and	CC
cord-002410-2zi5iv2t	259	12	HCV	HCV	NNP
cord-002410-2zi5iv2t	259	13	might	may	MD
cord-002410-2zi5iv2t	259	14	spur	spur	VB
cord-002410-2zi5iv2t	259	15	important	important	JJ
cord-002410-2zi5iv2t	259	16	future	future	JJ
cord-002410-2zi5iv2t	259	17	work	work	NN
cord-002410-2zi5iv2t	259	18	on	on	IN
cord-002410-2zi5iv2t	259	19	the	the	DT
cord-002410-2zi5iv2t	259	20	role	role	NN
cord-002410-2zi5iv2t	259	21	and	and	CC
cord-002410-2zi5iv2t	259	22	possible	possible	JJ
cord-002410-2zi5iv2t	259	23	therapeutic	therapeutic	JJ
cord-002410-2zi5iv2t	259	24	application	application	NN
cord-002410-2zi5iv2t	259	25	of	of	IN
cord-002410-2zi5iv2t	259	26	IFNL	IFNL	NNP
cord-002410-2zi5iv2t	259	27	during	during	IN
cord-002410-2zi5iv2t	259	28	infection	infection	NN
cord-002410-2zi5iv2t	259	29	with	with	IN
cord-002410-2zi5iv2t	259	30	other	other	JJ
cord-002410-2zi5iv2t	259	31	viruses	virus	NNS
cord-002410-2zi5iv2t	259	32	infecting	infect	VBG
cord-002410-2zi5iv2t	259	33	IFNLR	IFNLR	NNP
cord-002410-2zi5iv2t	259	34	expressing	express	VBG
cord-002410-2zi5iv2t	259	35	tissues	tissue	NNS
cord-002410-2zi5iv2t	259	36	,	,	,
cord-002410-2zi5iv2t	259	37	in	in	IN
cord-002410-2zi5iv2t	259	38	particular	particular	JJ
cord-002410-2zi5iv2t	259	39	the	the	DT
cord-002410-2zi5iv2t	259	40	liver	liver	NN
cord-002410-2zi5iv2t	259	41	and	and	CC
cord-002410-2zi5iv2t	259	42	the	the	DT
cord-002410-2zi5iv2t	259	43	lung	lung	NN
cord-002410-2zi5iv2t	259	44	.	.	.
cord-002410-2zi5iv2t	260	1	IFN	IFN	NNP
cord-002410-2zi5iv2t	260	2	-	-	HYPH
cord-002410-2zi5iv2t	260	3	s	s	NNP
cord-002410-2zi5iv2t	260	4	mediate	mediate	VB
cord-002410-2zi5iv2t	260	5	antiviral	antiviral	JJ
cord-002410-2zi5iv2t	260	6	protection	protection	NN
cord-002410-2zi5iv2t	260	7	through	through	IN
cord-002410-2zi5iv2t	260	8	a	a	DT
cord-002410-2zi5iv2t	260	9	distinct	distinct	JJ
cord-002410-2zi5iv2t	260	10	class	class	NN
cord-002410-2zi5iv2t	260	11	II	ii	NN
cord-002410-2zi5iv2t	260	12	cytokine	cytokine	NN
cord-002410-2zi5iv2t	260	13	receptor	receptor	NN
cord-002410-2zi5iv2t	260	14	complex	complex	NN
cord-002410-2zi5iv2t	261	1	IL-28	IL-28	NNP
cord-002410-2zi5iv2t	261	2	,	,	,
cord-002410-2zi5iv2t	261	3	IL-29	IL-29	NNP
cord-002410-2zi5iv2t	262	1	and	and	CC
cord-002410-2zi5iv2t	262	2	their	-PRON-	PRP$
cord-002410-2zi5iv2t	262	3	class	class	NN
cord-002410-2zi5iv2t	262	4	II	ii	CD
cord-002410-2zi5iv2t	262	5	cytokine	cytokine	NN
cord-002410-2zi5iv2t	262	6	receptor	receptor	NN
cord-002410-2zi5iv2t	263	1	IL-28R	IL-28R	NNP
cord-002410-2zi5iv2t	264	1	Interferon	interferon	NN
cord-002410-2zi5iv2t	264	2	lambda	lambda	NN
cord-002410-2zi5iv2t	264	3	4	4	CD
cord-002410-2zi5iv2t	264	4	signals	signal	NNS
cord-002410-2zi5iv2t	264	5	via	via	IN
cord-002410-2zi5iv2t	264	6	the	the	DT
cord-002410-2zi5iv2t	264	7	IFN	IFN	NNP
cord-002410-2zi5iv2t	264	8	receptor	receptor	NN
cord-002410-2zi5iv2t	264	9	to	to	TO
cord-002410-2zi5iv2t	264	10	regulate	regulate	VB
cord-002410-2zi5iv2t	264	11	antiviral	antiviral	JJ
cord-002410-2zi5iv2t	264	12	activity	activity	NN
cord-002410-2zi5iv2t	264	13	against	against	IN
cord-002410-2zi5iv2t	264	14	HCV	HCV	NNP
cord-002410-2zi5iv2t	264	15	and	and	CC
cord-002410-2zi5iv2t	264	16	coronaviruses	coronaviruses	NNP
cord-002410-2zi5iv2t	265	1	A	a	DT
cord-002410-2zi5iv2t	265	2	variant	variant	NN
cord-002410-2zi5iv2t	265	3	upstream	upstream	NN
cord-002410-2zi5iv2t	265	4	of	of	IN
cord-002410-2zi5iv2t	265	5	IFNL3	ifnl3	XX
cord-002410-2zi5iv2t	266	1	(	(	-LRB-
cord-002410-2zi5iv2t	266	2	IL28B	il28b	NN
cord-002410-2zi5iv2t	266	3	)	)	-RRB-
cord-002410-2zi5iv2t	266	4	creating	create	VBG
cord-002410-2zi5iv2t	266	5	a	a	DT
cord-002410-2zi5iv2t	266	6	new	new	JJ
cord-002410-2zi5iv2t	266	7	interferon	interferon	NN
cord-002410-2zi5iv2t	266	8	gene	gene	NN
cord-002410-2zi5iv2t	266	9	IFNL4	IFNL4	NNP
cord-002410-2zi5iv2t	266	10	is	be	VBZ
cord-002410-2zi5iv2t	266	11	associated	associate	VBN
cord-002410-2zi5iv2t	266	12	with	with	IN
cord-002410-2zi5iv2t	266	13	impaired	impaired	JJ
cord-002410-2zi5iv2t	266	14	clearance	clearance	NN
cord-002410-2zi5iv2t	266	15	of	of	IN
cord-002410-2zi5iv2t	266	16	hepatitis	hepatitis	NN
cord-002410-2zi5iv2t	266	17	C	C	NNP
cord-002410-2zi5iv2t	266	18	virus	virus	NN
cord-002410-2zi5iv2t	266	19	Interferon	Interferon	NNP
cord-002410-2zi5iv2t	266	20	-	-	HYPH
cord-002410-2zi5iv2t	266	21	lambda	lambda	NNP
cord-002410-2zi5iv2t	266	22	:	:	:
cord-002410-2zi5iv2t	266	23	a	a	DT
cord-002410-2zi5iv2t	266	24	new	new	JJ
cord-002410-2zi5iv2t	266	25	addition	addition	NN
cord-002410-2zi5iv2t	266	26	to	to	IN
cord-002410-2zi5iv2t	266	27	an	an	DT
cord-002410-2zi5iv2t	266	28	old	old	JJ
cord-002410-2zi5iv2t	266	29	family	family	NN
cord-002410-2zi5iv2t	267	1	The	the	DT
cord-002410-2zi5iv2t	267	2	family	family	NN
cord-002410-2zi5iv2t	267	3	of	of	IN
cord-002410-2zi5iv2t	267	4	IL-10-related	il-10-relate	VBN
cord-002410-2zi5iv2t	267	5	cytokines	cytokine	NNS
cord-002410-2zi5iv2t	267	6	and	and	CC
cord-002410-2zi5iv2t	267	7	their	-PRON-	PRP$
cord-002410-2zi5iv2t	267	8	receptors	receptor	NNS
cord-002410-2zi5iv2t	267	9	:	:	:
cord-002410-2zi5iv2t	267	10	related	relate	VBN
cord-002410-2zi5iv2t	267	11	,	,	,
cord-002410-2zi5iv2t	267	12	but	but	CC
cord-002410-2zi5iv2t	267	13	to	to	IN
cord-002410-2zi5iv2t	267	14	what	what	WDT
cord-002410-2zi5iv2t	267	15	extent	extent	NN
cord-002410-2zi5iv2t	267	16	?	?	.
cord-002410-2zi5iv2t	268	1	The	the	DT
cord-002410-2zi5iv2t	268	2	role	role	NN
cord-002410-2zi5iv2t	268	3	of	of	IN
cord-002410-2zi5iv2t	268	4	genomic	genomic	JJ
cord-002410-2zi5iv2t	268	5	data	datum	NNS
cord-002410-2zi5iv2t	268	6	in	in	IN
cord-002410-2zi5iv2t	268	7	the	the	DT
cord-002410-2zi5iv2t	268	8	discovery	discovery	NN
cord-002410-2zi5iv2t	268	9	,	,	,
cord-002410-2zi5iv2t	268	10	annotation	annotation	NN
cord-002410-2zi5iv2t	268	11	and	and	CC
cord-002410-2zi5iv2t	268	12	evolutionary	evolutionary	JJ
cord-002410-2zi5iv2t	268	13	interpretation	interpretation	NN
cord-002410-2zi5iv2t	268	14	of	of	IN
cord-002410-2zi5iv2t	268	15	the	the	DT
cord-002410-2zi5iv2t	268	16	interferon	interferon	NN
cord-002410-2zi5iv2t	268	17	-	-	HYPH
cord-002410-2zi5iv2t	268	18	lambda	lambda	NN
cord-002410-2zi5iv2t	268	19	family	family	NN
cord-002410-2zi5iv2t	268	20	Expression	expression	NN
cord-002410-2zi5iv2t	268	21	profiles	profile	NNS
cord-002410-2zi5iv2t	268	22	of	of	IN
cord-002410-2zi5iv2t	268	23	human	human	JJ
cord-002410-2zi5iv2t	268	24	interferon	interferon	NN
cord-002410-2zi5iv2t	268	25	-	-	HYPH
cord-002410-2zi5iv2t	268	26	alpha	alpha	NN
cord-002410-2zi5iv2t	268	27	and	and	CC
cord-002410-2zi5iv2t	268	28	interferon	interferon	NN
cord-002410-2zi5iv2t	268	29	-	-	HYPH
cord-002410-2zi5iv2t	268	30	lambda	lambda	NN
cord-002410-2zi5iv2t	268	31	subtypes	subtype	NNS
cord-002410-2zi5iv2t	268	32	are	be	VBP
cord-002410-2zi5iv2t	268	33	ligand	ligand	NN
cord-002410-2zi5iv2t	268	34	-	-	HYPH
cord-002410-2zi5iv2t	268	35	and	and	CC
cord-002410-2zi5iv2t	268	36	cell	cell	NN
cord-002410-2zi5iv2t	268	37	-	-	HYPH
cord-002410-2zi5iv2t	268	38	dependent	dependent	JJ
cord-002410-2zi5iv2t	268	39	Suppression	suppression	NN
cord-002410-2zi5iv2t	268	40	of	of	IN
cord-002410-2zi5iv2t	268	41	the	the	DT
cord-002410-2zi5iv2t	268	42	induction	induction	NN
cord-002410-2zi5iv2t	268	43	of	of	IN
cord-002410-2zi5iv2t	268	44	alpha	alpha	NN
cord-002410-2zi5iv2t	268	45	,	,	,
cord-002410-2zi5iv2t	268	46	beta	beta	NN
cord-002410-2zi5iv2t	268	47	,	,	,
cord-002410-2zi5iv2t	268	48	and	and	CC
cord-002410-2zi5iv2t	268	49	lambda	lambda	NN
cord-002410-2zi5iv2t	268	50	interferons	interferon	NNS
cord-002410-2zi5iv2t	268	51	by	by	IN
cord-002410-2zi5iv2t	268	52	the	the	DT
cord-002410-2zi5iv2t	268	53	NS1	NS1	NNS
cord-002410-2zi5iv2t	268	54	and	and	CC
cord-002410-2zi5iv2t	268	55	NS2	NS2	NNP
cord-002410-2zi5iv2t	268	56	proteins	protein	NNS
cord-002410-2zi5iv2t	268	57	of	of	IN
cord-002410-2zi5iv2t	268	58	human	human	JJ
cord-002410-2zi5iv2t	268	59	respiratory	respiratory	JJ
cord-002410-2zi5iv2t	268	60	syncytial	syncytial	JJ
cord-002410-2zi5iv2t	268	61	virus	virus	NN
cord-002410-2zi5iv2t	268	62	in	in	IN
cord-002410-2zi5iv2t	268	63	human	human	JJ
cord-002410-2zi5iv2t	268	64	epithelial	epithelial	JJ
cord-002410-2zi5iv2t	268	65	cells	cell	NNS
cord-002410-2zi5iv2t	268	66	and	and	CC
cord-002410-2zi5iv2t	268	67	macrophages	macrophage	NNS
cord-002410-2zi5iv2t	268	68	Toll	toll	NN
cord-002410-2zi5iv2t	268	69	-	-	HYPH
cord-002410-2zi5iv2t	268	70	like	like	JJ
cord-002410-2zi5iv2t	268	71	receptor	receptor	NN
cord-002410-2zi5iv2t	268	72	expression	expression	NN
cord-002410-2zi5iv2t	268	73	and	and	CC
cord-002410-2zi5iv2t	268	74	induction	induction	NN
cord-002410-2zi5iv2t	268	75	of	of	IN
cord-002410-2zi5iv2t	268	76	type	type	NN
cord-002410-2zi5iv2t	268	77	I	-PRON-	PRP
cord-002410-2zi5iv2t	268	78	and	and	CC
cord-002410-2zi5iv2t	268	79	type	type	NN
cord-002410-2zi5iv2t	268	80	III	iii	CD
cord-002410-2zi5iv2t	268	81	interferons	interferon	NNS
cord-002410-2zi5iv2t	268	82	in	in	IN
cord-002410-2zi5iv2t	268	83	primary	primary	JJ
cord-002410-2zi5iv2t	268	84	airway	airway	NN
cord-002410-2zi5iv2t	268	85	epithelial	epithelial	NN
cord-002410-2zi5iv2t	268	86	cells	cell	NNS
cord-002410-2zi5iv2t	269	1	Lambda	lambda	NN
cord-002410-2zi5iv2t	269	2	interferon	interferon	NN
cord-002410-2zi5iv2t	269	3	(	(	-LRB-
cord-002410-2zi5iv2t	269	4	IFN-	IFN-	NNP
cord-002410-2zi5iv2t	269	5	)	)	-RRB-
cord-002410-2zi5iv2t	269	6	,	,	,
cord-002410-2zi5iv2t	269	7	a	a	DT
cord-002410-2zi5iv2t	269	8	type	type	NN
cord-002410-2zi5iv2t	269	9	III	III	NNP
cord-002410-2zi5iv2t	269	10	IFN	IFN	NNP
cord-002410-2zi5iv2t	269	11	,	,	,
cord-002410-2zi5iv2t	269	12	is	be	VBZ
cord-002410-2zi5iv2t	269	13	induced	induce	VBN
cord-002410-2zi5iv2t	269	14	by	by	IN
cord-002410-2zi5iv2t	269	15	viruses	virus	NNS
cord-002410-2zi5iv2t	269	16	and	and	CC
cord-002410-2zi5iv2t	269	17	IFNs	ifn	NNS
cord-002410-2zi5iv2t	269	18	and	and	CC
cord-002410-2zi5iv2t	269	19	displays	display	VBZ
cord-002410-2zi5iv2t	269	20	potent	potent	JJ
cord-002410-2zi5iv2t	269	21	antiviral	antiviral	JJ
cord-002410-2zi5iv2t	269	22	activity	activity	NN
cord-002410-2zi5iv2t	269	23	against	against	IN
cord-002410-2zi5iv2t	269	24	select	select	JJ
cord-002410-2zi5iv2t	269	25	virus	virus	NN
cord-002410-2zi5iv2t	269	26	infections	infection	NNS
cord-002410-2zi5iv2t	269	27	in	in	IN
cord-002410-2zi5iv2t	269	28	vivo	vivo	NN
cord-002410-2zi5iv2t	269	29	Viral	viral	JJ
cord-002410-2zi5iv2t	269	30	infection	infection	NN
cord-002410-2zi5iv2t	269	31	and	and	CC
cord-002410-2zi5iv2t	270	1	toll	toll	NN
cord-002410-2zi5iv2t	270	2	-	-	HYPH
cord-002410-2zi5iv2t	270	3	like	like	JJ
cord-002410-2zi5iv2t	270	4	receptor	receptor	NN
cord-002410-2zi5iv2t	270	5	agonists	agonist	NNS
cord-002410-2zi5iv2t	270	6	induce	induce	VBP
cord-002410-2zi5iv2t	270	7	a	a	DT
cord-002410-2zi5iv2t	270	8	differential	differential	JJ
cord-002410-2zi5iv2t	270	9	expression	expression	NN
cord-002410-2zi5iv2t	270	10	of	of	IN
cord-002410-2zi5iv2t	270	11	type	type	NN
cord-002410-2zi5iv2t	270	12	I	-PRON-	PRP
cord-002410-2zi5iv2t	270	13	and	and	CC
cord-002410-2zi5iv2t	270	14	interferons	interferon	NNS
cord-002410-2zi5iv2t	270	15	in	in	IN
cord-002410-2zi5iv2t	270	16	humans	human	NNS
cord-002410-2zi5iv2t	270	17	plasmacytoid	plasmacytoid	NNP
cord-002410-2zi5iv2t	270	18	and	and	CC
cord-002410-2zi5iv2t	270	19	monocyte	monocyte	NNP
cord-002410-2zi5iv2t	270	20	-	-	HYPH
cord-002410-2zi5iv2t	270	21	derived	derive	VBN
cord-002410-2zi5iv2t	270	22	dendritic	dendritic	JJ
cord-002410-2zi5iv2t	270	23	cells	cell	NNS
cord-002410-2zi5iv2t	271	1	Interferonlambda	interferonlambda	NN
cord-002410-2zi5iv2t	271	2	serum	serum	NN
cord-002410-2zi5iv2t	271	3	levels	level	NNS
cord-002410-2zi5iv2t	271	4	in	in	IN
cord-002410-2zi5iv2t	271	5	hepatitis	hepatitis	NN
cord-002410-2zi5iv2t	271	6	C	C	NNP
cord-002410-2zi5iv2t	271	7	Comparative	Comparative	NNP
cord-002410-2zi5iv2t	271	8	analysis	analysis	NN
cord-002410-2zi5iv2t	271	9	of	of	IN
cord-002410-2zi5iv2t	271	10	the	the	DT
cord-002410-2zi5iv2t	271	11	lambda	lambda	NN
cord-002410-2zi5iv2t	271	12	-	-	HYPH
cord-002410-2zi5iv2t	271	13	interferons	interferon	NNS
cord-002410-2zi5iv2t	272	1	IL-28A	IL-28A	NNP
cord-002410-2zi5iv2t	273	1	and	and	CC
cord-002410-2zi5iv2t	273	2	IL-29	IL-29	NNP
cord-002410-2zi5iv2t	273	3	regarding	regard	VBG
cord-002410-2zi5iv2t	273	4	their	-PRON-	PRP$
cord-002410-2zi5iv2t	273	5	transcriptome	transcriptome	NN
cord-002410-2zi5iv2t	273	6	and	and	CC
cord-002410-2zi5iv2t	273	7	their	-PRON-	PRP$
cord-002410-2zi5iv2t	273	8	antiviral	antiviral	JJ
cord-002410-2zi5iv2t	273	9	properties	property	NNS
cord-002410-2zi5iv2t	273	10	against	against	IN
cord-002410-2zi5iv2t	273	11	hepatitis	hepatitis	NN
cord-002410-2zi5iv2t	273	12	C	C	NNP
cord-002410-2zi5iv2t	273	13	virus	virus	NN
cord-002410-2zi5iv2t	274	1	Interferon	interferon	NN
cord-002410-2zi5iv2t	274	2	type	type	NN
cord-002410-2zi5iv2t	274	3	I	-PRON-	PRP
cord-002410-2zi5iv2t	274	4	gene	gene	NN
cord-002410-2zi5iv2t	274	5	expression	expression	NN
cord-002410-2zi5iv2t	274	6	in	in	IN
cord-002410-2zi5iv2t	274	7	chronic	chronic	JJ
cord-002410-2zi5iv2t	274	8	hepatitis	hepatitis	NN
cord-002410-2zi5iv2t	274	9	C	c	NN
cord-002410-2zi5iv2t	275	1	The	the	DT
cord-002410-2zi5iv2t	275	2	impact	impact	NN
cord-002410-2zi5iv2t	275	3	of	of	IN
cord-002410-2zi5iv2t	275	4	the	the	DT
cord-002410-2zi5iv2t	275	5	interferon	interferon	NN
cord-002410-2zi5iv2t	275	6	-	-	HYPH
cord-002410-2zi5iv2t	275	7	lambda	lambda	NN
cord-002410-2zi5iv2t	275	8	family	family	NN
cord-002410-2zi5iv2t	275	9	on	on	IN
cord-002410-2zi5iv2t	275	10	the	the	DT
cord-002410-2zi5iv2t	275	11	innate	innate	JJ
cord-002410-2zi5iv2t	275	12	and	and	CC
cord-002410-2zi5iv2t	275	13	adaptive	adaptive	JJ
cord-002410-2zi5iv2t	275	14	immune	immune	JJ
cord-002410-2zi5iv2t	275	15	response	response	NN
cord-002410-2zi5iv2t	275	16	to	to	IN
cord-002410-2zi5iv2t	275	17	viral	viral	JJ
cord-002410-2zi5iv2t	275	18	infections	infection	NNS
cord-002410-2zi5iv2t	275	19	A	a	DT
cord-002410-2zi5iv2t	275	20	systematic	systematic	JJ
cord-002410-2zi5iv2t	275	21	analysis	analysis	NN
cord-002410-2zi5iv2t	275	22	of	of	IN
cord-002410-2zi5iv2t	275	23	host	host	NN
cord-002410-2zi5iv2t	275	24	factors	factor	NNS
cord-002410-2zi5iv2t	275	25	reveals	reveal	VBZ
cord-002410-2zi5iv2t	275	26	a	a	DT
cord-002410-2zi5iv2t	275	27	Med23-interferon	med23-interferon	JJ
cord-002410-2zi5iv2t	275	28	-	-	HYPH
cord-002410-2zi5iv2t	275	29	regulatory	regulatory	JJ
cord-002410-2zi5iv2t	275	30	axis	axis	NN
cord-002410-2zi5iv2t	275	31	against	against	IN
cord-002410-2zi5iv2t	275	32	herpes	herpes	NNP
cord-002410-2zi5iv2t	275	33	simplex	simplex	NNP
cord-002410-2zi5iv2t	275	34	virus	virus	NN
cord-002410-2zi5iv2t	275	35	type	type	NN
cord-002410-2zi5iv2t	275	36	1	1	CD
cord-002410-2zi5iv2t	275	37	replication	replication	NN
cord-002410-2zi5iv2t	276	1	Maturing	mature	VBG
cord-002410-2zi5iv2t	276	2	dendritic	dendritic	JJ
cord-002410-2zi5iv2t	276	3	cells	cell	NNS
cord-002410-2zi5iv2t	276	4	are	be	VBP
cord-002410-2zi5iv2t	276	5	an	an	DT
cord-002410-2zi5iv2t	276	6	important	important	JJ
cord-002410-2zi5iv2t	276	7	source	source	NN
cord-002410-2zi5iv2t	276	8	of	of	IN
cord-002410-2zi5iv2t	276	9	IL-29	IL-29	NNP
cord-002410-2zi5iv2t	277	1	and	and	CC
cord-002410-2zi5iv2t	277	2	IL-20	IL-20	NNP
cord-002410-2zi5iv2t	277	3	that	that	WDT
cord-002410-2zi5iv2t	277	4	may	may	MD
cord-002410-2zi5iv2t	277	5	cooperatively	cooperatively	RB
cord-002410-2zi5iv2t	277	6	increase	increase	VB
cord-002410-2zi5iv2t	277	7	the	the	DT
cord-002410-2zi5iv2t	277	8	innate	innate	JJ
cord-002410-2zi5iv2t	277	9	immunity	immunity	NN
cord-002410-2zi5iv2t	277	10	of	of	IN
cord-002410-2zi5iv2t	277	11	keratinocytes	keratinocyte	NNS
cord-002410-2zi5iv2t	277	12	Type	Type	NNP
cord-002410-2zi5iv2t	277	13	III	III	NNP
cord-002410-2zi5iv2t	277	14	IFNs	ifn	NNS
cord-002410-2zi5iv2t	277	15	are	be	VBP
cord-002410-2zi5iv2t	277	16	produced	produce	VBN
cord-002410-2zi5iv2t	277	17	by	by	IN
cord-002410-2zi5iv2t	277	18	and	and	CC
cord-002410-2zi5iv2t	277	19	stimulate	stimulate	VB
cord-002410-2zi5iv2t	277	20	human	human	JJ
cord-002410-2zi5iv2t	277	21	plasmacytoid	plasmacytoid	NN
cord-002410-2zi5iv2t	277	22	dendritic	dendritic	JJ
cord-002410-2zi5iv2t	277	23	cells	cell	NNS
cord-002410-2zi5iv2t	278	1	Mouse	Mouse	NNP
cord-002410-2zi5iv2t	278	2	CD8	CD8	NNP
cord-002410-2zi5iv2t	278	3	+	+	CC
cord-002410-2zi5iv2t	278	4	DCs	DCs	NNP
cord-002410-2zi5iv2t	278	5	and	and	CC
cord-002410-2zi5iv2t	278	6	human	human	JJ
cord-002410-2zi5iv2t	278	7	BDCA3	BDCA3	NNP
cord-002410-2zi5iv2t	278	8	+	+	CC
cord-002410-2zi5iv2t	278	9	DCs	DCs	NNP
cord-002410-2zi5iv2t	278	10	are	be	VBP
cord-002410-2zi5iv2t	278	11	major	major	JJ
cord-002410-2zi5iv2t	278	12	producers	producer	NNS
cord-002410-2zi5iv2t	278	13	of	of	IN
cord-002410-2zi5iv2t	278	14	IFN	IFN	NNP
cord-002410-2zi5iv2t	278	15	-	-	HYPH
cord-002410-2zi5iv2t	278	16	in	in	RP
cord-002410-2zi5iv2t	278	17	response	response	NN
cord-002410-2zi5iv2t	278	18	to	to	IN
cord-002410-2zi5iv2t	278	19	poly	poly	NN
cord-002410-2zi5iv2t	278	20	IC	IC	NNP
cord-002410-2zi5iv2t	279	1	IL-4	IL-4	NNP
cord-002410-2zi5iv2t	279	2	enhances	enhance	VBZ
cord-002410-2zi5iv2t	279	3	IFN-1	IFN-1	NNP
cord-002410-2zi5iv2t	279	4	(	(	-LRB-
cord-002410-2zi5iv2t	279	5	IL-29	IL-29	NNP
cord-002410-2zi5iv2t	279	6	)	)	-RRB-
cord-002410-2zi5iv2t	279	7	production	production	NN
cord-002410-2zi5iv2t	279	8	by	by	IN
cord-002410-2zi5iv2t	279	9	plasmacytoid	plasmacytoid	NNP
cord-002410-2zi5iv2t	279	10	DCs	DCs	NNP
cord-002410-2zi5iv2t	279	11	via	via	IN
cord-002410-2zi5iv2t	279	12	monocyte	monocyte	NNP
cord-002410-2zi5iv2t	279	13	secretion	secretion	NN
cord-002410-2zi5iv2t	279	14	of	of	IN
cord-002410-2zi5iv2t	279	15	IL-1Ra	IL-1Ra	NNP
cord-002410-2zi5iv2t	279	16	Lambda	Lambda	NNP
cord-002410-2zi5iv2t	280	1	interferon	interferon	NNP
cord-002410-2zi5iv2t	280	2	is	be	VBZ
cord-002410-2zi5iv2t	280	3	the	the	DT
cord-002410-2zi5iv2t	280	4	predominant	predominant	JJ
cord-002410-2zi5iv2t	280	5	interferon	interferon	NN
cord-002410-2zi5iv2t	280	6	induced	induce	VBN
cord-002410-2zi5iv2t	280	7	by	by	IN
cord-002410-2zi5iv2t	280	8	influenza	influenza	NN
cord-002410-2zi5iv2t	280	9	A	a	DT
cord-002410-2zi5iv2t	280	10	virus	virus	NN
cord-002410-2zi5iv2t	280	11	infection	infection	NN
cord-002410-2zi5iv2t	280	12	in	in	IN
cord-002410-2zi5iv2t	280	13	vivo	vivo	NNP
cord-002410-2zi5iv2t	280	14	Respiratory	respiratory	JJ
cord-002410-2zi5iv2t	280	15	virus	virus	NN
cord-002410-2zi5iv2t	280	16	induction	induction	NN
cord-002410-2zi5iv2t	280	17	of	of	IN
cord-002410-2zi5iv2t	280	18	alpha-	alpha-	NN
cord-002410-2zi5iv2t	280	19	,	,	,
cord-002410-2zi5iv2t	280	20	beta	beta	NN
cord-002410-2zi5iv2t	280	21	-	-	HYPH
cord-002410-2zi5iv2t	280	22	and	and	CC
cord-002410-2zi5iv2t	280	23	lambda	lambda	NN
cord-002410-2zi5iv2t	280	24	-	-	HYPH
cord-002410-2zi5iv2t	280	25	interferons	interferon	NNS
cord-002410-2zi5iv2t	280	26	in	in	IN
cord-002410-2zi5iv2t	280	27	bronchial	bronchial	JJ
cord-002410-2zi5iv2t	280	28	epithelial	epithelial	JJ
cord-002410-2zi5iv2t	280	29	cells	cell	NNS
cord-002410-2zi5iv2t	280	30	and	and	CC
cord-002410-2zi5iv2t	281	1	peripheral	peripheral	JJ
cord-002410-2zi5iv2t	281	2	blood	blood	NN
cord-002410-2zi5iv2t	281	3	mononuclear	mononuclear	NN
cord-002410-2zi5iv2t	281	4	cells	cell	NNS
cord-002410-2zi5iv2t	281	5	MyD88	MyD88	NNS
cord-002410-2zi5iv2t	281	6	is	be	VBZ
cord-002410-2zi5iv2t	281	7	required	require	VBN
cord-002410-2zi5iv2t	281	8	for	for	IN
cord-002410-2zi5iv2t	281	9	protection	protection	NN
cord-002410-2zi5iv2t	281	10	from	from	IN
cord-002410-2zi5iv2t	281	11	lethal	lethal	JJ
cord-002410-2zi5iv2t	281	12	infection	infection	NN
cord-002410-2zi5iv2t	281	13	with	with	IN
cord-002410-2zi5iv2t	281	14	a	a	DT
cord-002410-2zi5iv2t	281	15	mouseadapted	mouseadapted	JJ
cord-002410-2zi5iv2t	281	16	SARS	SARS	NNP
cord-002410-2zi5iv2t	281	17	-	-	HYPH
cord-002410-2zi5iv2t	281	18	CoV	cov	NN
cord-002410-2zi5iv2t	281	19	HCV	HCV	NNP
cord-002410-2zi5iv2t	281	20	infection	infection	NN
cord-002410-2zi5iv2t	281	21	selectively	selectively	RB
cord-002410-2zi5iv2t	281	22	impairs	impair	VBZ
cord-002410-2zi5iv2t	281	23	type	type	NN
cord-002410-2zi5iv2t	281	24	i	i	PRP
cord-002410-2zi5iv2t	281	25	but	but	CC
cord-002410-2zi5iv2t	281	26	not	not	RB
cord-002410-2zi5iv2t	281	27	type	type	VB
cord-002410-2zi5iv2t	281	28	III	III	NNP
cord-002410-2zi5iv2t	281	29	IFN	IFN	NNP
cord-002410-2zi5iv2t	281	30	signaling	signal	VBG
cord-002410-2zi5iv2t	281	31	Lambda	lambda	NN
cord-002410-2zi5iv2t	282	1	interferon	interferon	NNP
cord-002410-2zi5iv2t	282	2	inhibits	inhibit	VBZ
cord-002410-2zi5iv2t	283	1	human	human	JJ
cord-002410-2zi5iv2t	283	2	immunodeficiency	immunodeficiency	NN
cord-002410-2zi5iv2t	283	3	virus	virus	NN
cord-002410-2zi5iv2t	283	4	type	type	NN
cord-002410-2zi5iv2t	283	5	1	1	CD
cord-002410-2zi5iv2t	283	6	infection	infection	NN
cord-002410-2zi5iv2t	283	7	of	of	IN
cord-002410-2zi5iv2t	283	8	macrophages	macrophage	NNS
cord-002410-2zi5iv2t	284	1	An	an	DT
cord-002410-2zi5iv2t	284	2	important	important	JJ
cord-002410-2zi5iv2t	284	3	role	role	NN
cord-002410-2zi5iv2t	284	4	for	for	IN
cord-002410-2zi5iv2t	284	5	type	type	NN
cord-002410-2zi5iv2t	284	6	III	iii	CD
cord-002410-2zi5iv2t	285	1	interferon	interferon	NNP
cord-002410-2zi5iv2t	286	1	(	(	-LRB-
cord-002410-2zi5iv2t	286	2	IFN-/IL-28	ifn-/il-28	UH
cord-002410-2zi5iv2t	286	3	)	)	-RRB-
cord-002410-2zi5iv2t	286	4	in	in	IN
cord-002410-2zi5iv2t	286	5	TLR	TLR	NNP
cord-002410-2zi5iv2t	286	6	-	-	HYPH
cord-002410-2zi5iv2t	286	7	induced	induce	VBN
cord-002410-2zi5iv2t	286	8	antiviral	antiviral	JJ
cord-002410-2zi5iv2t	286	9	activity	activity	NN
cord-002410-2zi5iv2t	286	10	Alpha	alpha	NN
cord-002410-2zi5iv2t	286	11	/	/	SYM
cord-002410-2zi5iv2t	286	12	beta	beta	NN
cord-002410-2zi5iv2t	287	1	interferon	interferon	NNP
cord-002410-2zi5iv2t	288	1	(	(	-LRB-
cord-002410-2zi5iv2t	288	2	IFN-/	IFN-/	NNP
cord-002410-2zi5iv2t	288	3	)	)	-RRB-
cord-002410-2zi5iv2t	288	4	-independent	-independent	JJ
cord-002410-2zi5iv2t	288	5	induction	induction	NN
cord-002410-2zi5iv2t	288	6	of	of	IN
cord-002410-2zi5iv2t	288	7	IFN-1	IFN-1	NNP
cord-002410-2zi5iv2t	288	8	(	(	-LRB-
cord-002410-2zi5iv2t	288	9	interleukin-29	interleukin-29	CD
cord-002410-2zi5iv2t	288	10	)	)	-RRB-
cord-002410-2zi5iv2t	288	11	in	in	IN
cord-002410-2zi5iv2t	288	12	response	response	NN
cord-002410-2zi5iv2t	288	13	to	to	IN
cord-002410-2zi5iv2t	288	14	Hantaan	Hantaan	NNP
cord-002410-2zi5iv2t	288	15	virus	virus	NN
cord-002410-2zi5iv2t	288	16	infection	infection	NN
cord-002410-2zi5iv2t	288	17	Viral	viral	JJ
cord-002410-2zi5iv2t	288	18	evasion	evasion	NN
cord-002410-2zi5iv2t	288	19	and	and	CC
cord-002410-2zi5iv2t	288	20	subversion	subversion	NN
cord-002410-2zi5iv2t	288	21	of	of	IN
cord-002410-2zi5iv2t	288	22	pattern	pattern	NN
cord-002410-2zi5iv2t	288	23	-	-	HYPH
cord-002410-2zi5iv2t	288	24	recognition	recognition	NN
cord-002410-2zi5iv2t	288	25	receptor	receptor	NN
cord-002410-2zi5iv2t	288	26	signalling	signal	VBG
cord-002410-2zi5iv2t	288	27	Virus	Virus	NNP
cord-002410-2zi5iv2t	288	28	infection	infection	NN
cord-002410-2zi5iv2t	288	29	induces	induce	VBZ
cord-002410-2zi5iv2t	288	30	the	the	DT
cord-002410-2zi5iv2t	288	31	assembly	assembly	NN
cord-002410-2zi5iv2t	288	32	of	of	IN
cord-002410-2zi5iv2t	288	33	coordinately	coordinately	NNP
cord-002410-2zi5iv2t	288	34	activated	activate	VBD
cord-002410-2zi5iv2t	288	35	transcription	transcription	NN
cord-002410-2zi5iv2t	288	36	factors	factor	NNS
cord-002410-2zi5iv2t	288	37	on	on	IN
cord-002410-2zi5iv2t	288	38	the	the	DT
cord-002410-2zi5iv2t	288	39	IFNenhancer	ifnenhancer	NN
cord-002410-2zi5iv2t	288	40	in	in	IN
cord-002410-2zi5iv2t	288	41	vivo	vivo	NN
cord-002410-2zi5iv2t	288	42	Viral	viral	JJ
cord-002410-2zi5iv2t	288	43	infections	infection	NNS
cord-002410-2zi5iv2t	288	44	activate	activate	VBP
cord-002410-2zi5iv2t	288	45	types	type	NNS
cord-002410-2zi5iv2t	289	1	I	-PRON-	PRP
cord-002410-2zi5iv2t	289	2	and	and	CC
cord-002410-2zi5iv2t	289	3	III	III	NNP
cord-002410-2zi5iv2t	289	4	interferon	interferon	NN
cord-002410-2zi5iv2t	289	5	genes	gene	NNS
cord-002410-2zi5iv2t	289	6	through	through	IN
cord-002410-2zi5iv2t	289	7	a	a	DT
cord-002410-2zi5iv2t	289	8	common	common	JJ
cord-002410-2zi5iv2t	289	9	mechanism	mechanism	NN
cord-002410-2zi5iv2t	290	1	IFN	IFN	NNP
cord-002410-2zi5iv2t	290	2	regulatory	regulatory	JJ
cord-002410-2zi5iv2t	290	3	factor	factor	NN
cord-002410-2zi5iv2t	290	4	family	family	NN
cord-002410-2zi5iv2t	290	5	members	member	NNS
cord-002410-2zi5iv2t	290	6	differentially	differentially	RB
cord-002410-2zi5iv2t	290	7	regulate	regulate	VBP
cord-002410-2zi5iv2t	290	8	the	the	DT
cord-002410-2zi5iv2t	290	9	expression	expression	NN
cord-002410-2zi5iv2t	290	10	of	of	IN
cord-002410-2zi5iv2t	290	11	type	type	NN
cord-002410-2zi5iv2t	290	12	III	III	NNP
cord-002410-2zi5iv2t	290	13	IFN	IFN	NNP
cord-002410-2zi5iv2t	290	14	(	(	-LRB-
cord-002410-2zi5iv2t	290	15	IFN-	IFN-	NNP
cord-002410-2zi5iv2t	290	16	)	)	-RRB-
cord-002410-2zi5iv2t	290	17	genes	gene	NNS
cord-002410-2zi5iv2t	290	18	The	the	DT
cord-002410-2zi5iv2t	290	19	role	role	NN
cord-002410-2zi5iv2t	290	20	of	of	IN
cord-002410-2zi5iv2t	290	21	transposable	transposable	JJ
cord-002410-2zi5iv2t	290	22	elements	element	NNS
cord-002410-2zi5iv2t	290	23	in	in	IN
cord-002410-2zi5iv2t	290	24	the	the	DT
cord-002410-2zi5iv2t	290	25	regulation	regulation	NN
cord-002410-2zi5iv2t	290	26	of	of	IN
cord-002410-2zi5iv2t	290	27	IFN-1	IFN-1	NNP
cord-002410-2zi5iv2t	290	28	gene	gene	NN
cord-002410-2zi5iv2t	290	29	expression	expression	NN
cord-002410-2zi5iv2t	291	1	The	the	DT
cord-002410-2zi5iv2t	291	2	role	role	NN
cord-002410-2zi5iv2t	291	3	of	of	IN
cord-002410-2zi5iv2t	291	4	differential	differential	JJ
cord-002410-2zi5iv2t	291	5	expression	expression	NN
cord-002410-2zi5iv2t	291	6	of	of	IN
cord-002410-2zi5iv2t	291	7	human	human	JJ
cord-002410-2zi5iv2t	291	8	interferon	interferon	NN
cord-002410-2zi5iv2t	291	9	-	-	:
cord-002410-2zi5iv2t	291	10	a	a	DT
cord-002410-2zi5iv2t	291	11	genes	gene	NNS
cord-002410-2zi5iv2t	291	12	in	in	IN
cord-002410-2zi5iv2t	291	13	antiviral	antiviral	JJ
cord-002410-2zi5iv2t	291	14	immunity	immunity	NN
cord-002410-2zi5iv2t	291	15	Type	type	NN
cord-002410-2zi5iv2t	292	1	I	-PRON-	PRP
cord-002410-2zi5iv2t	292	2	inteferon	inteferon	NNP
cord-002410-2zi5iv2t	292	3	gene	gene	NN
cord-002410-2zi5iv2t	292	4	induction	induction	NN
cord-002410-2zi5iv2t	292	5	by	by	IN
cord-002410-2zi5iv2t	292	6	the	the	DT
cord-002410-2zi5iv2t	292	7	interferon	interferon	NN
cord-002410-2zi5iv2t	292	8	regulatory	regulatory	JJ
cord-002410-2zi5iv2t	292	9	factor	factor	NN
cord-002410-2zi5iv2t	292	10	family	family	NN
cord-002410-2zi5iv2t	292	11	of	of	IN
cord-002410-2zi5iv2t	292	12	transcription	transcription	NN
cord-002410-2zi5iv2t	292	13	factors	factor	NNS
cord-002410-2zi5iv2t	293	1	Transcriptional	transcriptional	JJ
cord-002410-2zi5iv2t	293	2	regulation	regulation	NN
cord-002410-2zi5iv2t	293	3	of	of	IN
cord-002410-2zi5iv2t	293	4	IFN	IFN	NNP
cord-002410-2zi5iv2t	293	5	-	-	HYPH
cord-002410-2zi5iv2t	293	6	genes	gene	NNS
cord-002410-2zi5iv2t	293	7	in	in	IN
cord-002410-2zi5iv2t	293	8	hepatitis	hepatitis	NN
cord-002410-2zi5iv2t	293	9	C	C	NNP
cord-002410-2zi5iv2t	293	10	virus	virus	NN
cord-002410-2zi5iv2t	293	11	-	-	HYPH
cord-002410-2zi5iv2t	293	12	infected	infect	VBN
cord-002410-2zi5iv2t	293	13	hepatocytes	hepatocyte	NNS
cord-002410-2zi5iv2t	293	14	via	via	IN
cord-002410-2zi5iv2t	293	15	IRF-3•IRF-7•NF	irf-3•irf-7•nf	NN
cord-002410-2zi5iv2t	293	16	-	-	HYPH
cord-002410-2zi5iv2t	293	17	B	b	NN
cord-002410-2zi5iv2t	293	18	complex	complex	NN
cord-002410-2zi5iv2t	293	19	Fast	fast	JJ
cord-002410-2zi5iv2t	293	20	,	,	,
cord-002410-2zi5iv2t	293	21	scalable	scalable	JJ
cord-002410-2zi5iv2t	293	22	generation	generation	NN
cord-002410-2zi5iv2t	293	23	of	of	IN
cord-002410-2zi5iv2t	293	24	high	high	JJ
cord-002410-2zi5iv2t	293	25	-	-	HYPH
cord-002410-2zi5iv2t	293	26	quality	quality	NN
cord-002410-2zi5iv2t	293	27	protein	protein	NN
cord-002410-2zi5iv2t	293	28	multiple	multiple	JJ
cord-002410-2zi5iv2t	293	29	sequence	sequence	NN
cord-002410-2zi5iv2t	293	30	alignments	alignment	NNS
cord-002410-2zi5iv2t	293	31	using	use	VBG
cord-002410-2zi5iv2t	293	32	Clustal	Clustal	NNP
cord-002410-2zi5iv2t	293	33	Omega	Omega	NNP
cord-002410-2zi5iv2t	293	34	IFN-4	IFN-4	NNP
cord-002410-2zi5iv2t	293	35	:	:	:
cord-002410-2zi5iv2t	293	36	the	the	DT
cord-002410-2zi5iv2t	293	37	paradoxical	paradoxical	JJ
cord-002410-2zi5iv2t	293	38	new	new	JJ
cord-002410-2zi5iv2t	293	39	member	member	NN
cord-002410-2zi5iv2t	293	40	of	of	IN
cord-002410-2zi5iv2t	293	41	the	the	DT
cord-002410-2zi5iv2t	293	42	interferon	interferon	NNP
cord-002410-2zi5iv2t	293	43	lambda	lambda	NN
cord-002410-2zi5iv2t	293	44	family	family	NN
cord-002410-2zi5iv2t	294	1	Interferon	interferon	NN
cord-002410-2zi5iv2t	294	2	lambda	lambda	NN
cord-002410-2zi5iv2t	294	3	:	:	:
cord-002410-2zi5iv2t	294	4	opportunities	opportunity	NNS
cord-002410-2zi5iv2t	294	5	,	,	,
cord-002410-2zi5iv2t	294	6	risks	risk	NNS
cord-002410-2zi5iv2t	294	7	,	,	,
cord-002410-2zi5iv2t	294	8	and	and	CC
cord-002410-2zi5iv2t	294	9	uncertainties	uncertainty	NNS
cord-002410-2zi5iv2t	294	10	in	in	IN
cord-002410-2zi5iv2t	294	11	the	the	DT
cord-002410-2zi5iv2t	294	12	fight	fight	NN
cord-002410-2zi5iv2t	294	13	against	against	IN
cord-002410-2zi5iv2t	294	14	HCV	HCV	NNP
cord-002410-2zi5iv2t	294	15	Crystal	Crystal	NNP
cord-002410-2zi5iv2t	294	16	structure	structure	NN
cord-002410-2zi5iv2t	294	17	of	of	IN
cord-002410-2zi5iv2t	294	18	human	human	NN
cord-002410-2zi5iv2t	294	19	interferon-1	interferon-1	NNP
cord-002410-2zi5iv2t	294	20	in	in	IN
cord-002410-2zi5iv2t	294	21	complex	complex	NN
cord-002410-2zi5iv2t	294	22	with	with	IN
cord-002410-2zi5iv2t	294	23	its	-PRON-	PRP$
cord-002410-2zi5iv2t	294	24	high	high	JJ
cord-002410-2zi5iv2t	294	25	-	-	HYPH
cord-002410-2zi5iv2t	294	26	affinity	affinity	NN
cord-002410-2zi5iv2t	294	27	receptor	receptor	NN
cord-002410-2zi5iv2t	294	28	interferon	interferon	NN
cord-002410-2zi5iv2t	294	29	-	-	HYPH
cord-002410-2zi5iv2t	294	30	R1	r1	NN
cord-002410-2zi5iv2t	294	31	IL28RA	il28ra	DT
cord-002410-2zi5iv2t	294	32	polymorphism	polymorphism	NN
cord-002410-2zi5iv2t	294	33	(	(	-LRB-
cord-002410-2zi5iv2t	294	34	rs10903035	rs10903035	NN
cord-002410-2zi5iv2t	294	35	)	)	-RRB-
cord-002410-2zi5iv2t	294	36	is	be	VBZ
cord-002410-2zi5iv2t	294	37	associated	associate	VBN
cord-002410-2zi5iv2t	294	38	with	with	IN
cord-002410-2zi5iv2t	294	39	insulin	insulin	NN
cord-002410-2zi5iv2t	294	40	resistance	resistance	NN
cord-002410-2zi5iv2t	294	41	in	in	IN
cord-002410-2zi5iv2t	294	42	HIV	HIV	NNP
cord-002410-2zi5iv2t	294	43	/	/	SYM
cord-002410-2zi5iv2t	294	44	HCV	HCV	NNP
cord-002410-2zi5iv2t	294	45	-	-	HYPH
cord-002410-2zi5iv2t	294	46	coinfected	coinfecte	VBN
cord-002410-2zi5iv2t	294	47	patients	patient	NNS
cord-002410-2zi5iv2t	294	48	IL28B	il28b	NN
cord-002410-2zi5iv2t	294	49	is	be	VBZ
cord-002410-2zi5iv2t	294	50	associated	associate	VBN
cord-002410-2zi5iv2t	294	51	with	with	IN
cord-002410-2zi5iv2t	294	52	response	response	NN
cord-002410-2zi5iv2t	294	53	to	to	IN
cord-002410-2zi5iv2t	294	54	chronic	chronic	JJ
cord-002410-2zi5iv2t	294	55	hepatitis	hepatitis	NN
cord-002410-2zi5iv2t	294	56	C	c	NN
cord-002410-2zi5iv2t	294	57	interferon	interferon	NN
cord-002410-2zi5iv2t	294	58	-	-	:
cord-002410-2zi5iv2t	294	59	and	and	CC
cord-002410-2zi5iv2t	294	60	ribavirin	ribavirin	NN
cord-002410-2zi5iv2t	294	61	therapy	therapy	NN
cord-002410-2zi5iv2t	295	1	Interferon	interferon	NN
cord-002410-2zi5iv2t	295	2	-	-	:
cord-002410-2zi5iv2t	295	3	is	be	VBZ
cord-002410-2zi5iv2t	295	4	functionally	functionally	RB
cord-002410-2zi5iv2t	295	5	an	an	DT
cord-002410-2zi5iv2t	295	6	interferon	interferon	NN
cord-002410-2zi5iv2t	295	7	Journal	Journal	NNP
cord-002410-2zi5iv2t	295	8	of	of	IN
cord-002410-2zi5iv2t	295	9	Immunology	Immunology	NNP
cord-002410-2zi5iv2t	295	10	Research	Research	NNP
cord-002410-2zi5iv2t	295	11	but	but	CC
cord-002410-2zi5iv2t	295	12	structurally	structurally	RB
cord-002410-2zi5iv2t	295	13	related	related	JJ
cord-002410-2zi5iv2t	295	14	to	to	IN
cord-002410-2zi5iv2t	295	15	the	the	DT
cord-002410-2zi5iv2t	295	16	interleukin-10	interleukin-10	NNP
cord-002410-2zi5iv2t	295	17	family	family	NN
cord-002410-2zi5iv2t	295	18	Comparative	Comparative	NNP
cord-002410-2zi5iv2t	295	19	genomic	genomic	JJ
cord-002410-2zi5iv2t	295	20	analysis	analysis	NN
cord-002410-2zi5iv2t	295	21	of	of	IN
cord-002410-2zi5iv2t	295	22	the	the	DT
cord-002410-2zi5iv2t	295	23	interferon	interferon	NN
cord-002410-2zi5iv2t	295	24	/	/	SYM
cord-002410-2zi5iv2t	295	25	interleukin-10	interleukin-10	NN
cord-002410-2zi5iv2t	295	26	receptor	receptor	NN
cord-002410-2zi5iv2t	295	27	gene	gene	NN
cord-002410-2zi5iv2t	295	28	cluster	cluster	NN
cord-002410-2zi5iv2t	296	1	The	the	DT
cord-002410-2zi5iv2t	296	2	expanded	expand	VBN
cord-002410-2zi5iv2t	296	3	family	family	NN
cord-002410-2zi5iv2t	296	4	of	of	IN
cord-002410-2zi5iv2t	296	5	class	class	NN
cord-002410-2zi5iv2t	296	6	II	ii	CD
cord-002410-2zi5iv2t	296	7	cytokines	cytokine	NNS
cord-002410-2zi5iv2t	296	8	that	that	WDT
cord-002410-2zi5iv2t	296	9	share	share	VBP
cord-002410-2zi5iv2t	296	10	the	the	DT
cord-002410-2zi5iv2t	296	11	IL-10	IL-10	NNP
cord-002410-2zi5iv2t	296	12	receptor-2	receptor-2	NNP
cord-002410-2zi5iv2t	296	13	(	(	-LRB-
cord-002410-2zi5iv2t	296	14	IL-10R2	il-10r2	NN
cord-002410-2zi5iv2t	296	15	)	)	-RRB-
cord-002410-2zi5iv2t	296	16	chain	chain	NN
cord-002410-2zi5iv2t	296	17	IFNlambda	ifnlambda	NN
cord-002410-2zi5iv2t	296	18	(	(	-LRB-
cord-002410-2zi5iv2t	296	19	IFN-	IFN-	NNP
cord-002410-2zi5iv2t	296	20	)	)	-RRB-
cord-002410-2zi5iv2t	296	21	is	be	VBZ
cord-002410-2zi5iv2t	296	22	expressed	express	VBN
cord-002410-2zi5iv2t	296	23	in	in	IN
cord-002410-2zi5iv2t	296	24	a	a	DT
cord-002410-2zi5iv2t	296	25	tissue	tissue	NN
cord-002410-2zi5iv2t	296	26	-	-	HYPH
cord-002410-2zi5iv2t	296	27	dependent	dependent	JJ
cord-002410-2zi5iv2t	296	28	fashion	fashion	NN
cord-002410-2zi5iv2t	296	29	and	and	CC
cord-002410-2zi5iv2t	296	30	primarily	primarily	RB
cord-002410-2zi5iv2t	296	31	acts	act	VBZ
cord-002410-2zi5iv2t	296	32	on	on	IN
cord-002410-2zi5iv2t	296	33	epithelial	epithelial	JJ
cord-002410-2zi5iv2t	296	34	cells	cell	NNS
cord-002410-2zi5iv2t	296	35	in	in	IN
cord-002410-2zi5iv2t	296	36	vivo	vivo	NN
cord-002410-2zi5iv2t	297	1	Interferon	interferon	NN
cord-002410-2zi5iv2t	297	2	-	-	HYPH
cord-002410-2zi5iv2t	297	3	lambda	lambda	NNP
cord-002410-2zi5iv2t	297	4	(	(	-LRB-
cord-002410-2zi5iv2t	297	5	IFN-	IFN-	NNP
cord-002410-2zi5iv2t	297	6	)	)	-RRB-
cord-002410-2zi5iv2t	297	7	induces	induce	VBZ
cord-002410-2zi5iv2t	297	8	signal	signal	NN
cord-002410-2zi5iv2t	297	9	transduction	transduction	NN
cord-002410-2zi5iv2t	297	10	and	and	CC
cord-002410-2zi5iv2t	297	11	gene	gene	NN
cord-002410-2zi5iv2t	297	12	expression	expression	NN
cord-002410-2zi5iv2t	297	13	in	in	IN
cord-002410-2zi5iv2t	297	14	human	human	JJ
cord-002410-2zi5iv2t	297	15	hepatocytes	hepatocyte	NNS
cord-002410-2zi5iv2t	297	16	,	,	,
cord-002410-2zi5iv2t	297	17	but	but	CC
cord-002410-2zi5iv2t	297	18	not	not	RB
cord-002410-2zi5iv2t	297	19	in	in	IN
cord-002410-2zi5iv2t	297	20	lymphocytes	lymphocyte	NNS
cord-002410-2zi5iv2t	297	21	or	or	CC
cord-002410-2zi5iv2t	297	22	monocytes	monocyte	VBZ
cord-002410-2zi5iv2t	297	23	Purification	purification	NN
cord-002410-2zi5iv2t	297	24	,	,	,
cord-002410-2zi5iv2t	297	25	crystallization	crystallization	NN
cord-002410-2zi5iv2t	297	26	and	and	CC
cord-002410-2zi5iv2t	297	27	preliminary	preliminary	JJ
cord-002410-2zi5iv2t	297	28	crystallographic	crystallographic	JJ
cord-002410-2zi5iv2t	297	29	studies	study	NNS
cord-002410-2zi5iv2t	297	30	of	of	IN
cord-002410-2zi5iv2t	297	31	the	the	DT
cord-002410-2zi5iv2t	297	32	complex	complex	NN
cord-002410-2zi5iv2t	297	33	of	of	IN
cord-002410-2zi5iv2t	297	34	interferon-1	interferon-1	NNP
cord-002410-2zi5iv2t	297	35	with	with	IN
cord-002410-2zi5iv2t	297	36	its	-PRON-	PRP$
cord-002410-2zi5iv2t	297	37	receptor	receptor	NN
cord-002410-2zi5iv2t	298	1	Interleukin-29	Interleukin-29	NNP
cord-002410-2zi5iv2t	298	2	uses	use	VBZ
cord-002410-2zi5iv2t	298	3	a	a	DT
cord-002410-2zi5iv2t	298	4	type	type	NN
cord-002410-2zi5iv2t	298	5	1	1	CD
cord-002410-2zi5iv2t	298	6	interferon	interferon	NN
cord-002410-2zi5iv2t	298	7	-	-	HYPH
cord-002410-2zi5iv2t	298	8	like	like	JJ
cord-002410-2zi5iv2t	298	9	program	program	NN
cord-002410-2zi5iv2t	298	10	to	to	TO
cord-002410-2zi5iv2t	298	11	promote	promote	VB
cord-002410-2zi5iv2t	298	12	antiviral	antiviral	JJ
cord-002410-2zi5iv2t	298	13	responses	response	NNS
cord-002410-2zi5iv2t	298	14	in	in	IN
cord-002410-2zi5iv2t	298	15	human	human	JJ
cord-002410-2zi5iv2t	298	16	hepatocytes	hepatocyte	NNS
cord-002410-2zi5iv2t	299	1	The	the	DT
cord-002410-2zi5iv2t	299	2	structure	structure	NN
cord-002410-2zi5iv2t	299	3	of	of	IN
cord-002410-2zi5iv2t	299	4	human	human	JJ
cord-002410-2zi5iv2t	299	5	interferon	interferon	NNP
cord-002410-2zi5iv2t	299	6	lambda	lambda	NNP
cord-002410-2zi5iv2t	299	7	and	and	CC
cord-002410-2zi5iv2t	299	8	what	what	WP
cord-002410-2zi5iv2t	299	9	it	-PRON-	PRP
cord-002410-2zi5iv2t	299	10	has	have	VBZ
cord-002410-2zi5iv2t	299	11	taught	teach	VBN
cord-002410-2zi5iv2t	299	12	us	-PRON-	PRP
cord-002410-2zi5iv2t	299	13	Transcriptional	Transcriptional	NNP
cord-002410-2zi5iv2t	299	14	regulation	regulation	NN
cord-002410-2zi5iv2t	299	15	by	by	IN
cord-002410-2zi5iv2t	299	16	STAT1	stat1	NN
cord-002410-2zi5iv2t	299	17	and	and	CC
cord-002410-2zi5iv2t	299	18	STAT2	STAT2	NNS
cord-002410-2zi5iv2t	299	19	in	in	IN
cord-002410-2zi5iv2t	299	20	the	the	DT
cord-002410-2zi5iv2t	299	21	interferon	interferon	NN
cord-002410-2zi5iv2t	299	22	JAK	JAK	NNP
cord-002410-2zi5iv2t	299	23	-	-	HYPH
cord-002410-2zi5iv2t	299	24	STAT	STAT	NNP
cord-002410-2zi5iv2t	299	25	pathway	pathway	NN
cord-002410-2zi5iv2t	299	26	Interferon	interferon	NN
cord-002410-2zi5iv2t	299	27	-	-	HYPH
cord-002410-2zi5iv2t	299	28	inducible	inducible	JJ
cord-002410-2zi5iv2t	299	29	antiviral	antiviral	JJ
cord-002410-2zi5iv2t	299	30	effectors	effector	NNS
cord-002410-2zi5iv2t	300	1	Interferon	interferon	NN
cord-002410-2zi5iv2t	300	2	lambdas	lambda	NNS
cord-002410-2zi5iv2t	300	3	:	:	:
cord-002410-2zi5iv2t	300	4	the	the	DT
cord-002410-2zi5iv2t	300	5	next	next	JJ
cord-002410-2zi5iv2t	300	6	cytokine	cytokine	NN
cord-002410-2zi5iv2t	300	7	storm	storm	NN
cord-002410-2zi5iv2t	301	1	The	the	DT
cord-002410-2zi5iv2t	301	2	stability	stability	NN
cord-002410-2zi5iv2t	301	3	of	of	IN
cord-002410-2zi5iv2t	301	4	the	the	DT
cord-002410-2zi5iv2t	301	5	ternary	ternary	JJ
cord-002410-2zi5iv2t	301	6	interferon	interferon	NN
cord-002410-2zi5iv2t	301	7	-	-	HYPH
cord-002410-2zi5iv2t	301	8	receptor	receptor	NN
cord-002410-2zi5iv2t	301	9	complex	complex	NN
cord-002410-2zi5iv2t	301	10	rather	rather	RB
cord-002410-2zi5iv2t	301	11	than	than	IN
cord-002410-2zi5iv2t	301	12	the	the	DT
cord-002410-2zi5iv2t	301	13	affinity	affinity	NN
cord-002410-2zi5iv2t	301	14	to	to	IN
cord-002410-2zi5iv2t	301	15	the	the	DT
cord-002410-2zi5iv2t	301	16	individual	individual	JJ
cord-002410-2zi5iv2t	301	17	subunits	subunit	NNS
cord-002410-2zi5iv2t	301	18	dictates	dictate	VBZ
cord-002410-2zi5iv2t	301	19	differential	differential	JJ
cord-002410-2zi5iv2t	301	20	biological	biological	JJ
cord-002410-2zi5iv2t	301	21	activities	activity	NNS
cord-002410-2zi5iv2t	301	22	Dynamic	dynamic	JJ
cord-002410-2zi5iv2t	301	23	expression	expression	NN
cord-002410-2zi5iv2t	301	24	profiling	profiling	NN
cord-002410-2zi5iv2t	301	25	of	of	IN
cord-002410-2zi5iv2t	301	26	type	type	NN
cord-002410-2zi5iv2t	301	27	I	-PRON-	PRP
cord-002410-2zi5iv2t	301	28	and	and	CC
cord-002410-2zi5iv2t	302	1	type	type	NNP
cord-002410-2zi5iv2t	302	2	III	III	NNP
cord-002410-2zi5iv2t	302	3	interferonstimulated	interferonstimulate	VBN
cord-002410-2zi5iv2t	302	4	hepatocytes	hepatocyte	NNS
cord-002410-2zi5iv2t	302	5	reveals	reveal	VBZ
cord-002410-2zi5iv2t	302	6	a	a	DT
cord-002410-2zi5iv2t	302	7	stable	stable	JJ
cord-002410-2zi5iv2t	302	8	hierarchy	hierarchy	NN
cord-002410-2zi5iv2t	302	9	of	of	IN
cord-002410-2zi5iv2t	302	10	gene	gene	NN
cord-002410-2zi5iv2t	302	11	expression	expression	NN
cord-002410-2zi5iv2t	302	12	Differential	differential	JJ
cord-002410-2zi5iv2t	302	13	effects	effect	NNS
cord-002410-2zi5iv2t	302	14	of	of	IN
cord-002410-2zi5iv2t	302	15	type	type	NN
cord-002410-2zi5iv2t	302	16	I	-PRON-	PRP
cord-002410-2zi5iv2t	302	17	and	and	CC
cord-002410-2zi5iv2t	302	18	II	II	NNP
cord-002410-2zi5iv2t	302	19	interferons	interferon	NNS
cord-002410-2zi5iv2t	302	20	on	on	IN
cord-002410-2zi5iv2t	302	21	myeloid	myeloid	JJ
cord-002410-2zi5iv2t	302	22	cells	cell	NNS
cord-002410-2zi5iv2t	302	23	and	and	CC
cord-002410-2zi5iv2t	302	24	resistance	resistance	NN
cord-002410-2zi5iv2t	302	25	to	to	IN
cord-002410-2zi5iv2t	303	1	intracellular	intracellular	JJ
cord-002410-2zi5iv2t	303	2	bacterial	bacterial	JJ
cord-002410-2zi5iv2t	303	3	infections	infection	NNS
cord-002410-2zi5iv2t	303	4	Interferonstimulated	interferonstimulate	VBN
cord-002410-2zi5iv2t	303	5	genes	gene	NNS
cord-002410-2zi5iv2t	303	6	:	:	:
cord-002410-2zi5iv2t	303	7	a	a	DT
cord-002410-2zi5iv2t	303	8	complex	complex	JJ
cord-002410-2zi5iv2t	303	9	web	web	NN
cord-002410-2zi5iv2t	303	10	of	of	IN
cord-002410-2zi5iv2t	303	11	host	host	NN
cord-002410-2zi5iv2t	303	12	defenses	defense	NNS
cord-002410-2zi5iv2t	304	1	New	new	JJ
cord-002410-2zi5iv2t	304	2	regulators	regulator	NNS
cord-002410-2zi5iv2t	304	3	of	of	IN
cord-002410-2zi5iv2t	304	4	NF	nf	NN
cord-002410-2zi5iv2t	304	5	-	-	HYPH
cord-002410-2zi5iv2t	304	6	B	b	NN
cord-002410-2zi5iv2t	304	7	in	in	IN
cord-002410-2zi5iv2t	304	8	inflammation	inflammation	NN
cord-002410-2zi5iv2t	305	1	Combined	combined	JJ
cord-002410-2zi5iv2t	305	2	action	action	NN
cord-002410-2zi5iv2t	305	3	of	of	IN
cord-002410-2zi5iv2t	305	4	type	type	NN
cord-002410-2zi5iv2t	306	1	I	-PRON-	PRP
cord-002410-2zi5iv2t	306	2	and	and	CC
cord-002410-2zi5iv2t	306	3	type	type	NN
cord-002410-2zi5iv2t	306	4	III	iii	CD
cord-002410-2zi5iv2t	307	1	interferon	interferon	NN
cord-002410-2zi5iv2t	307	2	restricts	restrict	VBZ
cord-002410-2zi5iv2t	307	3	initial	initial	JJ
cord-002410-2zi5iv2t	307	4	replication	replication	NN
cord-002410-2zi5iv2t	307	5	of	of	IN
cord-002410-2zi5iv2t	307	6	severe	severe	JJ
cord-002410-2zi5iv2t	307	7	acute	acute	JJ
cord-002410-2zi5iv2t	307	8	respiratory	respiratory	JJ
cord-002410-2zi5iv2t	307	9	syndrome	syndrome	NN
cord-002410-2zi5iv2t	307	10	coronavirus	coronavirus	NN
cord-002410-2zi5iv2t	307	11	in	in	IN
cord-002410-2zi5iv2t	307	12	the	the	DT
cord-002410-2zi5iv2t	307	13	lung	lung	NN
cord-002410-2zi5iv2t	307	14	but	but	CC
cord-002410-2zi5iv2t	307	15	fails	fail	VBZ
cord-002410-2zi5iv2t	307	16	to	to	TO
cord-002410-2zi5iv2t	307	17	inhibit	inhibit	VB
cord-002410-2zi5iv2t	307	18	systemic	systemic	JJ
cord-002410-2zi5iv2t	307	19	virus	virus	NN
cord-002410-2zi5iv2t	307	20	spread	spread	VBN
cord-002410-2zi5iv2t	307	21	SOCS	SOCS	NNP
cord-002410-2zi5iv2t	307	22	proteins	protein	NNS
cord-002410-2zi5iv2t	307	23	,	,	,
cord-002410-2zi5iv2t	307	24	cytokine	cytokine	NN
cord-002410-2zi5iv2t	307	25	signalling	signalling	NN
cord-002410-2zi5iv2t	307	26	and	and	CC
cord-002410-2zi5iv2t	307	27	immune	immune	JJ
cord-002410-2zi5iv2t	307	28	regulation	regulation	NN
cord-002410-2zi5iv2t	308	1	USP18-based	usp18-base	VBN
cord-002410-2zi5iv2t	309	1	negative	negative	JJ
cord-002410-2zi5iv2t	309	2	feedback	feedback	NN
cord-002410-2zi5iv2t	309	3	control	control	NN
cord-002410-2zi5iv2t	309	4	is	be	VBZ
cord-002410-2zi5iv2t	309	5	induced	induce	VBN
cord-002410-2zi5iv2t	309	6	by	by	IN
cord-002410-2zi5iv2t	309	7	type	type	NN
cord-002410-2zi5iv2t	309	8	I	-PRON-	PRP
cord-002410-2zi5iv2t	309	9	and	and	CC
cord-002410-2zi5iv2t	309	10	type	type	NN
cord-002410-2zi5iv2t	309	11	III	iii	CD
cord-002410-2zi5iv2t	309	12	interferons	interferon	NNS
cord-002410-2zi5iv2t	309	13	and	and	CC
cord-002410-2zi5iv2t	309	14	specifically	specifically	RB
cord-002410-2zi5iv2t	309	15	inactivates	inactivate	VBZ
cord-002410-2zi5iv2t	309	16	interferon	interferon	NN
cord-002410-2zi5iv2t	309	17	response	response	NN
cord-002410-2zi5iv2t	310	1	Human	Human	NNP
cord-002410-2zi5iv2t	310	2	interferon-3	interferon-3	NNP
cord-002410-2zi5iv2t	310	3	is	be	VBZ
cord-002410-2zi5iv2t	310	4	a	a	DT
cord-002410-2zi5iv2t	310	5	potent	potent	JJ
cord-002410-2zi5iv2t	310	6	member	member	NN
cord-002410-2zi5iv2t	310	7	of	of	IN
cord-002410-2zi5iv2t	310	8	the	the	DT
cord-002410-2zi5iv2t	310	9	type	type	NN
cord-002410-2zi5iv2t	310	10	III	iii	CD
cord-002410-2zi5iv2t	310	11	interferon	interferon	NN
cord-002410-2zi5iv2t	310	12	family	family	NN
cord-002410-2zi5iv2t	310	13	Expanded	expand	VBD
cord-002410-2zi5iv2t	310	14	classification	classification	NN
cord-002410-2zi5iv2t	310	15	of	of	IN
cord-002410-2zi5iv2t	310	16	hepatitis	hepatitis	NN
cord-002410-2zi5iv2t	310	17	C	C	NNP
cord-002410-2zi5iv2t	310	18	virus	virus	NN
cord-002410-2zi5iv2t	310	19	into	into	IN
cord-002410-2zi5iv2t	310	20	7	7	CD
cord-002410-2zi5iv2t	310	21	genotypes	genotype	NNS
cord-002410-2zi5iv2t	310	22	and	and	CC
cord-002410-2zi5iv2t	310	23	67	67	CD
cord-002410-2zi5iv2t	310	24	subtypes	subtype	NNS
cord-002410-2zi5iv2t	310	25	:	:	:
cord-002410-2zi5iv2t	311	1	updated	update	VBN
cord-002410-2zi5iv2t	311	2	criteria	criterion	NNS
cord-002410-2zi5iv2t	311	3	and	and	CC
cord-002410-2zi5iv2t	311	4	genotype	genotype	NN
cord-002410-2zi5iv2t	311	5	assignment	assignment	NN
cord-002410-2zi5iv2t	311	6	web	web	NN
cord-002410-2zi5iv2t	311	7	resource	resource	NN
cord-002410-2zi5iv2t	312	1	The	the	DT
cord-002410-2zi5iv2t	312	2	ins	in	NNS
cord-002410-2zi5iv2t	312	3	and	and	CC
cord-002410-2zi5iv2t	312	4	outs	out	NNS
cord-002410-2zi5iv2t	312	5	of	of	IN
cord-002410-2zi5iv2t	312	6	hepatitis	hepatitis	NN
cord-002410-2zi5iv2t	312	7	C	C	NNP
cord-002410-2zi5iv2t	312	8	virus	virus	NN
cord-002410-2zi5iv2t	312	9	entry	entry	NN
cord-002410-2zi5iv2t	312	10	and	and	CC
cord-002410-2zi5iv2t	312	11	assembly	assembly	NN
cord-002410-2zi5iv2t	312	12	Hepatitis	Hepatitis	NNP
cord-002410-2zi5iv2t	312	13	C	C	NNP
cord-002410-2zi5iv2t	312	14	virus	virus	NN
cord-002410-2zi5iv2t	312	15	RNA	RNA	NNP
cord-002410-2zi5iv2t	312	16	replication	replication	NN
cord-002410-2zi5iv2t	312	17	and	and	CC
cord-002410-2zi5iv2t	312	18	assembly	assembly	NN
cord-002410-2zi5iv2t	312	19	:	:	:
cord-002410-2zi5iv2t	312	20	living	live	VBG
cord-002410-2zi5iv2t	312	21	on	on	IN
cord-002410-2zi5iv2t	312	22	the	the	DT
cord-002410-2zi5iv2t	312	23	fat	fat	NN
cord-002410-2zi5iv2t	312	24	of	of	IN
cord-002410-2zi5iv2t	312	25	the	the	DT
cord-002410-2zi5iv2t	312	26	land	land	NN
cord-002410-2zi5iv2t	312	27	Global	global	JJ
cord-002410-2zi5iv2t	312	28	epidemiology	epidemiology	NN
cord-002410-2zi5iv2t	312	29	and	and	CC
cord-002410-2zi5iv2t	312	30	genotype	genotype	NN
cord-002410-2zi5iv2t	312	31	distribution	distribution	NN
cord-002410-2zi5iv2t	312	32	of	of	IN
cord-002410-2zi5iv2t	312	33	the	the	DT
cord-002410-2zi5iv2t	312	34	hepatitis	hepatitis	NN
cord-002410-2zi5iv2t	312	35	C	C	NNP
cord-002410-2zi5iv2t	312	36	virus	virus	NN
cord-002410-2zi5iv2t	312	37	infection	infection	NN
cord-002410-2zi5iv2t	312	38	Global	global	JJ
cord-002410-2zi5iv2t	312	39	epidemiology	epidemiology	NN
cord-002410-2zi5iv2t	312	40	of	of	IN
cord-002410-2zi5iv2t	312	41	hepatitis	hepatitis	NN
cord-002410-2zi5iv2t	312	42	B	B	NNP
cord-002410-2zi5iv2t	312	43	and	and	CC
cord-002410-2zi5iv2t	312	44	hepatitis	hepatitis	NN
cord-002410-2zi5iv2t	312	45	C	C	NNP
cord-002410-2zi5iv2t	312	46	in	in	IN
cord-002410-2zi5iv2t	312	47	people	people	NNS
cord-002410-2zi5iv2t	312	48	who	who	WP
cord-002410-2zi5iv2t	312	49	inject	inject	VBP
cord-002410-2zi5iv2t	312	50	drugs	drug	NNS
cord-002410-2zi5iv2t	312	51	:	:	:
cord-002410-2zi5iv2t	312	52	results	result	NNS
cord-002410-2zi5iv2t	312	53	of	of	IN
cord-002410-2zi5iv2t	312	54	systematic	systematic	JJ
cord-002410-2zi5iv2t	312	55	reviews	review	NNS
cord-002410-2zi5iv2t	313	1	The	the	DT
cord-002410-2zi5iv2t	313	2	impact	impact	NN
cord-002410-2zi5iv2t	313	3	of	of	IN
cord-002410-2zi5iv2t	313	4	hepatitis	hepatitis	NN
cord-002410-2zi5iv2t	313	5	C	C	NNP
cord-002410-2zi5iv2t	313	6	virus	virus	NN
cord-002410-2zi5iv2t	313	7	entry	entry	NN
cord-002410-2zi5iv2t	313	8	on	on	IN
cord-002410-2zi5iv2t	313	9	viral	viral	JJ
cord-002410-2zi5iv2t	313	10	tropism	tropism	NN
cord-002410-2zi5iv2t	313	11	The	the	DT
cord-002410-2zi5iv2t	313	12	CD81	CD81	NNP
cord-002410-2zi5iv2t	313	13	partner	partner	NN
cord-002410-2zi5iv2t	314	1	EWI-2wint	EWI-2wint	NNP
cord-002410-2zi5iv2t	314	2	inhibits	inhibit	VBZ
cord-002410-2zi5iv2t	314	3	hepatitis	hepatitis	NN
cord-002410-2zi5iv2t	314	4	C	C	NNP
cord-002410-2zi5iv2t	314	5	virus	virus	NN
cord-002410-2zi5iv2t	314	6	entry	entry	NN
cord-002410-2zi5iv2t	314	7	Guidelines	guideline	NNS
cord-002410-2zi5iv2t	314	8	for	for	IN
cord-002410-2zi5iv2t	314	9	the	the	DT
cord-002410-2zi5iv2t	314	10	screening	screening	NN
cord-002410-2zi5iv2t	314	11	,	,	,
cord-002410-2zi5iv2t	314	12	care	care	NN
cord-002410-2zi5iv2t	314	13	and	and	CC
cord-002410-2zi5iv2t	314	14	treatment	treatment	NN
cord-002410-2zi5iv2t	314	15	of	of	IN
cord-002410-2zi5iv2t	314	16	persons	person	NNS
cord-002410-2zi5iv2t	314	17	with	with	IN
cord-002410-2zi5iv2t	314	18	chronic	chronic	JJ
cord-002410-2zi5iv2t	314	19	hepatitis	hepatitis	NN
cord-002410-2zi5iv2t	314	20	C	c	NN
cord-002410-2zi5iv2t	314	21	infection	infection	NN
cord-002410-2zi5iv2t	315	1	Recent	recent	JJ
cord-002410-2zi5iv2t	315	2	advances	advance	NNS
cord-002410-2zi5iv2t	315	3	in	in	IN
cord-002410-2zi5iv2t	315	4	understanding	understand	VBG
cord-002410-2zi5iv2t	315	5	hepatitis	hepatitis	NN
cord-002410-2zi5iv2t	315	6	C	C	NNP
cord-002410-2zi5iv2t	315	7	Emerging	emerge	VBG
cord-002410-2zi5iv2t	315	8	therapies	therapy	NNS
cord-002410-2zi5iv2t	315	9	for	for	IN
cord-002410-2zi5iv2t	315	10	the	the	DT
cord-002410-2zi5iv2t	315	11	treatment	treatment	NN
cord-002410-2zi5iv2t	315	12	of	of	IN
cord-002410-2zi5iv2t	315	13	hepatitis	hepatitis	NN
cord-002410-2zi5iv2t	315	14	C	C	NNP
cord-002410-2zi5iv2t	315	15	Regulating	Regulating	NNP
cord-002410-2zi5iv2t	315	16	intracellular	intracellular	JJ
cord-002410-2zi5iv2t	315	17	antiviral	antiviral	JJ
cord-002410-2zi5iv2t	315	18	defense	defense	NN
cord-002410-2zi5iv2t	315	19	and	and	CC
cord-002410-2zi5iv2t	315	20	permissiveness	permissiveness	NN
cord-002410-2zi5iv2t	315	21	to	to	IN
cord-002410-2zi5iv2t	315	22	hepatitis	hepatitis	NNP
cord-002410-2zi5iv2t	315	23	C	C	NNP
cord-002410-2zi5iv2t	315	24	virus	virus	NN
cord-002410-2zi5iv2t	315	25	RNA	RNA	NNP
cord-002410-2zi5iv2t	315	26	replication	replication	NN
cord-002410-2zi5iv2t	315	27	through	through	IN
cord-002410-2zi5iv2t	315	28	a	a	DT
cord-002410-2zi5iv2t	315	29	cellular	cellular	JJ
cord-002410-2zi5iv2t	315	30	RNA	rna	NN
cord-002410-2zi5iv2t	315	31	helicase	helicase	NN
cord-002410-2zi5iv2t	315	32	,	,	,
cord-002410-2zi5iv2t	315	33	RIG	rig	NN
cord-002410-2zi5iv2t	315	34	-	-	:
cord-002410-2zi5iv2t	315	35	I	I	NNP
cord-002410-2zi5iv2t	315	36	HepG2	HepG2	NNP
cord-002410-2zi5iv2t	315	37	cells	cell	NNS
cord-002410-2zi5iv2t	315	38	mount	mount	VBP
cord-002410-2zi5iv2t	315	39	an	an	DT
cord-002410-2zi5iv2t	315	40	effective	effective	JJ
cord-002410-2zi5iv2t	315	41	antiviral	antiviral	JJ
cord-002410-2zi5iv2t	315	42	interferon	interferon	NN
cord-002410-2zi5iv2t	315	43	-	-	HYPH
cord-002410-2zi5iv2t	315	44	lambda	lambda	NN
cord-002410-2zi5iv2t	315	45	based	base	VBN
cord-002410-2zi5iv2t	315	46	innate	innate	JJ
cord-002410-2zi5iv2t	315	47	immune	immune	JJ
cord-002410-2zi5iv2t	315	48	response	response	NN
cord-002410-2zi5iv2t	315	49	to	to	IN
cord-002410-2zi5iv2t	315	50	hepatitis	hepatitis	NNP
cord-002410-2zi5iv2t	315	51	C	C	NNP
cord-002410-2zi5iv2t	315	52	virus	virus	NN
cord-002410-2zi5iv2t	315	53	infection	infection	NN
cord-002410-2zi5iv2t	315	54	Hepatitis	Hepatitis	NNP
cord-002410-2zi5iv2t	315	55	C	C	NNP
cord-002410-2zi5iv2t	315	56	virus	virus	NN
cord-002410-2zi5iv2t	315	57	replicative	replicative	JJ
cord-002410-2zi5iv2t	315	58	doublestranded	doublestranded	NNP
cord-002410-2zi5iv2t	315	59	RNA	RNA	NNP
cord-002410-2zi5iv2t	315	60	is	be	VBZ
cord-002410-2zi5iv2t	315	61	a	a	DT
cord-002410-2zi5iv2t	315	62	potent	potent	JJ
cord-002410-2zi5iv2t	315	63	interferon	interferon	NN
cord-002410-2zi5iv2t	315	64	inducer	inducer	NN
cord-002410-2zi5iv2t	315	65	that	that	WDT
cord-002410-2zi5iv2t	315	66	triggers	trigger	VBZ
cord-002410-2zi5iv2t	315	67	interferon	interferon	NN
cord-002410-2zi5iv2t	315	68	production	production	NN
cord-002410-2zi5iv2t	315	69	through	through	IN
cord-002410-2zi5iv2t	315	70	MDA5	MDA5	NNP
cord-002410-2zi5iv2t	315	71	MAVS	MAVS	NNP
cord-002410-2zi5iv2t	315	72	forms	form	VBZ
cord-002410-2zi5iv2t	315	73	functional	functional	JJ
cord-002410-2zi5iv2t	315	74	prion	prion	NN
cord-002410-2zi5iv2t	315	75	-	-	HYPH
cord-002410-2zi5iv2t	315	76	like	like	JJ
cord-002410-2zi5iv2t	315	77	aggregates	aggregate	NNS
cord-002410-2zi5iv2t	315	78	to	to	TO
cord-002410-2zi5iv2t	315	79	activate	activate	VB
cord-002410-2zi5iv2t	315	80	and	and	CC
cord-002410-2zi5iv2t	315	81	propagate	propagate	VB
cord-002410-2zi5iv2t	315	82	antiviral	antiviral	JJ
cord-002410-2zi5iv2t	315	83	innate	innate	JJ
cord-002410-2zi5iv2t	315	84	immune	immune	JJ
cord-002410-2zi5iv2t	315	85	response	response	NN
cord-002410-2zi5iv2t	316	1	Class	Class	NNP
cord-002410-2zi5iv2t	316	2	A	a	DT
cord-002410-2zi5iv2t	316	3	scavenger	scavenger	NN
cord-002410-2zi5iv2t	316	4	receptor	receptor	NN
cord-002410-2zi5iv2t	316	5	1	1	CD
cord-002410-2zi5iv2t	316	6	(	(	-LRB-
cord-002410-2zi5iv2t	316	7	MSR1	MSR1	NNP
cord-002410-2zi5iv2t	316	8	)	)	-RRB-
cord-002410-2zi5iv2t	316	9	restricts	restrict	VBZ
cord-002410-2zi5iv2t	316	10	hepatitis	hepatitis	NN
cord-002410-2zi5iv2t	316	11	C	c	NN
cord-002410-2zi5iv2t	316	12	virus	virus	NN
cord-002410-2zi5iv2t	316	13	replication	replication	NN
cord-002410-2zi5iv2t	316	14	by	by	IN
cord-002410-2zi5iv2t	316	15	mediating	mediate	VBG
cord-002410-2zi5iv2t	316	16	toll	toll	NN
cord-002410-2zi5iv2t	316	17	-	-	HYPH
cord-002410-2zi5iv2t	316	18	like	like	JJ
cord-002410-2zi5iv2t	316	19	receptor	receptor	NN
cord-002410-2zi5iv2t	316	20	3	3	CD
cord-002410-2zi5iv2t	316	21	recognition	recognition	NN
cord-002410-2zi5iv2t	316	22	of	of	IN
cord-002410-2zi5iv2t	316	23	viral	viral	JJ
cord-002410-2zi5iv2t	316	24	RNAs	rna	NNS
cord-002410-2zi5iv2t	316	25	produced	produce	VBN
cord-002410-2zi5iv2t	316	26	in	in	IN
cord-002410-2zi5iv2t	316	27	neighboring	neighboring	NN
cord-002410-2zi5iv2t	316	28	cells	cell	NNS
cord-002410-2zi5iv2t	317	1	The	the	DT
cord-002410-2zi5iv2t	317	2	autophagy	autophagy	NN
cord-002410-2zi5iv2t	317	3	machinery	machinery	NN
cord-002410-2zi5iv2t	317	4	is	be	VBZ
cord-002410-2zi5iv2t	317	5	required	require	VBN
cord-002410-2zi5iv2t	317	6	to	to	TO
cord-002410-2zi5iv2t	317	7	initiate	initiate	VB
cord-002410-2zi5iv2t	317	8	hepatitis	hepatitis	NN
cord-002410-2zi5iv2t	317	9	C	C	NNP
cord-002410-2zi5iv2t	317	10	virus	virus	NN
cord-002410-2zi5iv2t	317	11	replication	replication	NN
cord-002410-2zi5iv2t	317	12	IKKE	IKKE	NNP
cord-002410-2zi5iv2t	317	13	and	and	CC
cord-002410-2zi5iv2t	317	14	TBKI	TBKI	NNP
cord-002410-2zi5iv2t	317	15	are	be	VBP
cord-002410-2zi5iv2t	317	16	essential	essential	JJ
cord-002410-2zi5iv2t	317	17	components	component	NNS
cord-002410-2zi5iv2t	317	18	of	of	IN
cord-002410-2zi5iv2t	317	19	the	the	DT
cord-002410-2zi5iv2t	317	20	IRF3	IRF3	NNP
cord-002410-2zi5iv2t	317	21	signalling	signal	VBG
cord-002410-2zi5iv2t	317	22	pathway	pathway	NN
cord-002410-2zi5iv2t	317	23	Identification	identification	NN
cord-002410-2zi5iv2t	317	24	and	and	CC
cord-002410-2zi5iv2t	317	25	characterization	characterization	NN
cord-002410-2zi5iv2t	317	26	of	of	IN
cord-002410-2zi5iv2t	317	27	MAVS	MAVS	NNPS
cord-002410-2zi5iv2t	317	28	,	,	,
cord-002410-2zi5iv2t	317	29	a	a	DT
cord-002410-2zi5iv2t	317	30	mitochondrial	mitochondrial	JJ
cord-002410-2zi5iv2t	317	31	antiviral	antiviral	JJ
cord-002410-2zi5iv2t	317	32	signaling	signal	VBG
cord-002410-2zi5iv2t	317	33	protein	protein	NN
cord-002410-2zi5iv2t	317	34	that	that	WDT
cord-002410-2zi5iv2t	317	35	activates	activate	VBZ
cord-002410-2zi5iv2t	317	36	NF	nf	NN
cord-002410-2zi5iv2t	317	37	-	-	HYPH
cord-002410-2zi5iv2t	317	38	B	B	NNP
cord-002410-2zi5iv2t	317	39	and	and	CC
cord-002410-2zi5iv2t	317	40	IRF3	IRF3	NNP
cord-002410-2zi5iv2t	317	41	Regulation	Regulation	NNP
cord-002410-2zi5iv2t	317	42	of	of	IN
cord-002410-2zi5iv2t	317	43	interferon	interferon	NN
cord-002410-2zi5iv2t	317	44	regulatory	regulatory	JJ
cord-002410-2zi5iv2t	317	45	factor-3	factor-3	NNP
cord-002410-2zi5iv2t	317	46	by	by	IN
cord-002410-2zi5iv2t	317	47	the	the	DT
cord-002410-2zi5iv2t	317	48	hepatitis	hepatitis	NN
cord-002410-2zi5iv2t	317	49	C	C	NNP
cord-002410-2zi5iv2t	317	50	virus	virus	NN
cord-002410-2zi5iv2t	317	51	serine	serine	NN
cord-002410-2zi5iv2t	317	52	protease	protease	NN
cord-002410-2zi5iv2t	318	1	Hepatitis	Hepatitis	NNP
cord-002410-2zi5iv2t	318	2	C	C	NNP
cord-002410-2zi5iv2t	318	3	virus	virus	NN
cord-002410-2zi5iv2t	318	4	protease	protease	NN
cord-002410-2zi5iv2t	318	5	NS3/4A	ns3/4a	PRP
cord-002410-2zi5iv2t	318	6	cleaves	cleave	VBZ
cord-002410-2zi5iv2t	318	7	mitochondrial	mitochondrial	JJ
cord-002410-2zi5iv2t	318	8	antiviral	antiviral	JJ
cord-002410-2zi5iv2t	318	9	signaling	signal	VBG
cord-002410-2zi5iv2t	318	10	protein	protein	NN
cord-002410-2zi5iv2t	318	11	off	off	IN
cord-002410-2zi5iv2t	318	12	the	the	DT
cord-002410-2zi5iv2t	318	13	mitochondria	mitochondrion	NNS
cord-002410-2zi5iv2t	318	14	to	to	TO
cord-002410-2zi5iv2t	318	15	evade	evade	VB
cord-002410-2zi5iv2t	318	16	innate	innate	JJ
cord-002410-2zi5iv2t	318	17	immunity	immunity	NN
cord-002410-2zi5iv2t	318	18	Cardif	Cardif	NNP
cord-002410-2zi5iv2t	318	19	is	be	VBZ
cord-002410-2zi5iv2t	318	20	an	an	DT
cord-002410-2zi5iv2t	318	21	adaptor	adaptor	NN
cord-002410-2zi5iv2t	318	22	protein	protein	NN
cord-002410-2zi5iv2t	318	23	in	in	IN
cord-002410-2zi5iv2t	318	24	the	the	DT
cord-002410-2zi5iv2t	318	25	RIG	rig	NN
cord-002410-2zi5iv2t	318	26	-	-	:
cord-002410-2zi5iv2t	318	27	I	I	NNP
cord-002410-2zi5iv2t	318	28	antiviral	antiviral	JJ
cord-002410-2zi5iv2t	318	29	pathway	pathway	NN
cord-002410-2zi5iv2t	318	30	and	and	CC
cord-002410-2zi5iv2t	318	31	is	be	VBZ
cord-002410-2zi5iv2t	318	32	targeted	target	VBN
cord-002410-2zi5iv2t	318	33	by	by	IN
cord-002410-2zi5iv2t	318	34	hepatitis	hepatitis	NN
cord-002410-2zi5iv2t	318	35	C	C	NNP
cord-002410-2zi5iv2t	318	36	virus	virus	NN
cord-002410-2zi5iv2t	318	37	Hepatitis	Hepatitis	NNP
cord-002410-2zi5iv2t	318	38	C	C	NNP
cord-002410-2zi5iv2t	318	39	virus	virus	NN
cord-002410-2zi5iv2t	318	40	NS3	ns3	RB
cord-002410-2zi5iv2t	318	41	-	-	HYPH
cord-002410-2zi5iv2t	318	42	4A	4a	NN
cord-002410-2zi5iv2t	318	43	inhibits	inhibit	VBZ
cord-002410-2zi5iv2t	318	44	the	the	DT
cord-002410-2zi5iv2t	318	45	peroxisomal	peroxisomal	JJ
cord-002410-2zi5iv2t	318	46	MAVS	mavs	RB
cord-002410-2zi5iv2t	318	47	-	-	HYPH
cord-002410-2zi5iv2t	318	48	dependent	dependent	JJ
cord-002410-2zi5iv2t	318	49	antiviral	antiviral	JJ
cord-002410-2zi5iv2t	318	50	signalling	signal	VBG
cord-002410-2zi5iv2t	318	51	response	response	NN
cord-002410-2zi5iv2t	319	1	Immune	immune	JJ
cord-002410-2zi5iv2t	319	2	evasion	evasion	NN
cord-002410-2zi5iv2t	319	3	by	by	IN
cord-002410-2zi5iv2t	319	4	hepatitis	hepatitis	NN
cord-002410-2zi5iv2t	319	5	C	C	NNP
cord-002410-2zi5iv2t	319	6	virus	virus	NN
cord-002410-2zi5iv2t	319	7	NS3/4A	ns3/4a	JJ
cord-002410-2zi5iv2t	319	8	protease	protease	NN
cord-002410-2zi5iv2t	319	9	-	-	HYPH
cord-002410-2zi5iv2t	319	10	mediated	mediate	VBN
cord-002410-2zi5iv2t	319	11	cleavage	cleavage	NN
cord-002410-2zi5iv2t	319	12	of	of	IN
cord-002410-2zi5iv2t	319	13	the	the	DT
cord-002410-2zi5iv2t	319	14	Toll	Toll	NNP
cord-002410-2zi5iv2t	319	15	-	-	HYPH
cord-002410-2zi5iv2t	319	16	like	like	JJ
cord-002410-2zi5iv2t	319	17	receptor	receptor	NN
cord-002410-2zi5iv2t	319	18	3	3	CD
cord-002410-2zi5iv2t	319	19	adaptor	adaptor	NN
cord-002410-2zi5iv2t	319	20	protein	protein	NN
cord-002410-2zi5iv2t	320	1	TRIF	TRIF	NNP
cord-002410-2zi5iv2t	321	1	Hepacivirus	Hepacivirus	NNP
cord-002410-2zi5iv2t	321	2	NS3/4A	ns3/4a	NN
cord-002410-2zi5iv2t	321	3	proteases	protease	NNS
cord-002410-2zi5iv2t	321	4	interfere	interfere	VBP
cord-002410-2zi5iv2t	321	5	with	with	IN
cord-002410-2zi5iv2t	321	6	MAVS	MAVS	NNPS
cord-002410-2zi5iv2t	321	7	signaling	signal	VBG
cord-002410-2zi5iv2t	321	8	in	in	IN
cord-002410-2zi5iv2t	321	9	both	both	DT
cord-002410-2zi5iv2t	321	10	their	-PRON-	PRP$
cord-002410-2zi5iv2t	321	11	cognate	cognate	JJ
cord-002410-2zi5iv2t	321	12	animal	animal	NN
cord-002410-2zi5iv2t	321	13	hosts	host	NNS
cord-002410-2zi5iv2t	321	14	and	and	CC
cord-002410-2zi5iv2t	321	15	humans	human	NNS
cord-002410-2zi5iv2t	321	16	:	:	:
cord-002410-2zi5iv2t	321	17	implications	implication	NNS
cord-002410-2zi5iv2t	321	18	for	for	IN
cord-002410-2zi5iv2t	321	19	zoonotic	zoonotic	JJ
cord-002410-2zi5iv2t	321	20	transmission	transmission	NN
cord-002410-2zi5iv2t	321	21	Type	type	NN
cord-002410-2zi5iv2t	321	22	III	III	NNP
cord-002410-2zi5iv2t	321	23	interferons	interferon	NNS
cord-002410-2zi5iv2t	321	24	,	,	,
cord-002410-2zi5iv2t	321	25	IL-28	IL-28	NNP
cord-002410-2zi5iv2t	321	26	and	and	CC
cord-002410-2zi5iv2t	321	27	IL-29	IL-29	NNP
cord-002410-2zi5iv2t	321	28	,	,	,
cord-002410-2zi5iv2t	321	29	are	be	VBP
cord-002410-2zi5iv2t	321	30	increased	increase	VBN
cord-002410-2zi5iv2t	321	31	in	in	IN
cord-002410-2zi5iv2t	321	32	chronic	chronic	JJ
cord-002410-2zi5iv2t	321	33	HCV	HCV	NNP
cord-002410-2zi5iv2t	321	34	infection	infection	NN
cord-002410-2zi5iv2t	321	35	and	and	CC
cord-002410-2zi5iv2t	321	36	induce	induce	VB
cord-002410-2zi5iv2t	321	37	myeloid	myeloid	JJ
cord-002410-2zi5iv2t	321	38	dendritic	dendritic	JJ
cord-002410-2zi5iv2t	321	39	cell	cell	NN
cord-002410-2zi5iv2t	321	40	-	-	HYPH
cord-002410-2zi5iv2t	321	41	mediated	mediate	VBN
cord-002410-2zi5iv2t	321	42	FoxP3	FoxP3	NNP
cord-002410-2zi5iv2t	321	43	+	+	CC
cord-002410-2zi5iv2t	321	44	regulatory	regulatory	JJ
cord-002410-2zi5iv2t	321	45	T	t	NN
cord-002410-2zi5iv2t	321	46	cells	cell	NNS
cord-002410-2zi5iv2t	322	1	HCV	HCV	NNP
cord-002410-2zi5iv2t	322	2	infection	infection	NN
cord-002410-2zi5iv2t	322	3	induces	induce	VBZ
cord-002410-2zi5iv2t	322	4	a	a	DT
cord-002410-2zi5iv2t	322	5	unique	unique	JJ
cord-002410-2zi5iv2t	322	6	hepatic	hepatic	JJ
cord-002410-2zi5iv2t	322	7	innate	innate	JJ
cord-002410-2zi5iv2t	322	8	immune	immune	JJ
cord-002410-2zi5iv2t	322	9	response	response	NN
cord-002410-2zi5iv2t	322	10	associated	associate	VBN
cord-002410-2zi5iv2t	322	11	with	with	IN
cord-002410-2zi5iv2t	322	12	robust	robust	JJ
cord-002410-2zi5iv2t	322	13	production	production	NN
cord-002410-2zi5iv2t	322	14	of	of	IN
cord-002410-2zi5iv2t	322	15	type	type	NN
cord-002410-2zi5iv2t	322	16	III	iii	CD
cord-002410-2zi5iv2t	322	17	interferons	interferon	NNS
cord-002410-2zi5iv2t	322	18	IFN	IFN	NNP
cord-002410-2zi5iv2t	322	19	-	-	HYPH
cord-002410-2zi5iv2t	322	20	receptor	receptor	NN
cord-002410-2zi5iv2t	322	21	1	1	CD
cord-002410-2zi5iv2t	322	22	expression	expression	NN
cord-002410-2zi5iv2t	322	23	is	be	VBZ
cord-002410-2zi5iv2t	322	24	induced	induce	VBN
cord-002410-2zi5iv2t	322	25	in	in	IN
cord-002410-2zi5iv2t	322	26	chronic	chronic	JJ
cord-002410-2zi5iv2t	322	27	hepatitis	hepatitis	NN
cord-002410-2zi5iv2t	322	28	C	c	NN
cord-002410-2zi5iv2t	322	29	and	and	CC
cord-002410-2zi5iv2t	322	30	correlates	correlate	VBZ
cord-002410-2zi5iv2t	322	31	with	with	IN
cord-002410-2zi5iv2t	322	32	the	the	DT
cord-002410-2zi5iv2t	322	33	IFN-3	IFN-3	NNP
cord-002410-2zi5iv2t	322	34	genotype	genotype	NN
cord-002410-2zi5iv2t	322	35	and	and	CC
cord-002410-2zi5iv2t	322	36	with	with	IN
cord-002410-2zi5iv2t	322	37	nonresponsiveness	nonresponsiveness	NN
cord-002410-2zi5iv2t	322	38	to	to	IN
cord-002410-2zi5iv2t	322	39	IFNtherapies	ifntherapie	NNS
cord-002410-2zi5iv2t	322	40	Reduced	reduce	VBD
cord-002410-2zi5iv2t	322	41	IFN	IFN	NNP
cord-002410-2zi5iv2t	322	42	4	4	CD
cord-002410-2zi5iv2t	322	43	activity	activity	NN
cord-002410-2zi5iv2t	322	44	is	be	VBZ
cord-002410-2zi5iv2t	322	45	associated	associate	VBN
cord-002410-2zi5iv2t	322	46	with	with	IN
cord-002410-2zi5iv2t	322	47	improved	improve	VBN
cord-002410-2zi5iv2t	322	48	HCV	HCV	NNP
cord-002410-2zi5iv2t	322	49	clearance	clearance	NN
cord-002410-2zi5iv2t	322	50	and	and	CC
cord-002410-2zi5iv2t	322	51	reduced	reduced	JJ
cord-002410-2zi5iv2t	322	52	expression	expression	NN
cord-002410-2zi5iv2t	322	53	of	of	IN
cord-002410-2zi5iv2t	322	54	interferon	interferon	NN
cord-002410-2zi5iv2t	322	55	-	-	HYPH
cord-002410-2zi5iv2t	322	56	stimulated	stimulate	VBN
cord-002410-2zi5iv2t	322	57	genes	gene	NNS
cord-002410-2zi5iv2t	322	58	IL-29	IL-29	NNP
cord-002410-2zi5iv2t	322	59	is	be	VBZ
cord-002410-2zi5iv2t	322	60	the	the	DT
cord-002410-2zi5iv2t	322	61	dominant	dominant	JJ
cord-002410-2zi5iv2t	322	62	type	type	NN
cord-002410-2zi5iv2t	322	63	III	iii	CD
cord-002410-2zi5iv2t	322	64	interferon	interferon	NN
cord-002410-2zi5iv2t	322	65	produced	produce	VBN
cord-002410-2zi5iv2t	322	66	by	by	IN
cord-002410-2zi5iv2t	322	67	hepatocytes	hepatocyte	NNS
cord-002410-2zi5iv2t	322	68	during	during	IN
cord-002410-2zi5iv2t	322	69	acute	acute	JJ
cord-002410-2zi5iv2t	322	70	hepatitis	hepatitis	NN
cord-002410-2zi5iv2t	322	71	C	c	NN
cord-002410-2zi5iv2t	322	72	virus	virus	NN
cord-002410-2zi5iv2t	322	73	infection	infection	NN
cord-002410-2zi5iv2t	322	74	Completion	completion	NN
cord-002410-2zi5iv2t	322	75	of	of	IN
cord-002410-2zi5iv2t	322	76	the	the	DT
cord-002410-2zi5iv2t	322	77	entire	entire	JJ
cord-002410-2zi5iv2t	322	78	hepatitis	hepatitis	NN
cord-002410-2zi5iv2t	322	79	C	C	NNP
cord-002410-2zi5iv2t	322	80	virus	virus	NN
cord-002410-2zi5iv2t	322	81	life	life	NN
cord-002410-2zi5iv2t	322	82	cycle	cycle	NN
cord-002410-2zi5iv2t	322	83	in	in	IN
cord-002410-2zi5iv2t	322	84	genetically	genetically	RB
cord-002410-2zi5iv2t	322	85	humanized	humanize	VBN
cord-002410-2zi5iv2t	322	86	mice	mouse	NNS
cord-002410-2zi5iv2t	322	87	Control	Control	NNP
cord-002410-2zi5iv2t	322	88	of	of	IN
cord-002410-2zi5iv2t	322	89	hepatitis	hepatitis	NNP
cord-002410-2zi5iv2t	322	90	C	C	NNP
cord-002410-2zi5iv2t	322	91	virus	virus	NN
cord-002410-2zi5iv2t	322	92	replication	replication	NN
cord-002410-2zi5iv2t	322	93	in	in	IN
cord-002410-2zi5iv2t	322	94	mouse	mouse	NN
cord-002410-2zi5iv2t	322	95	liver	liver	NN
cord-002410-2zi5iv2t	322	96	-	-	HYPH
cord-002410-2zi5iv2t	322	97	derived	derive	VBN
cord-002410-2zi5iv2t	322	98	cells	cell	NNS
cord-002410-2zi5iv2t	322	99	by	by	IN
cord-002410-2zi5iv2t	322	100	MAVS	mavs	RB
cord-002410-2zi5iv2t	322	101	-	-	HYPH
cord-002410-2zi5iv2t	322	102	dependent	dependent	JJ
cord-002410-2zi5iv2t	322	103	production	production	NN
cord-002410-2zi5iv2t	322	104	of	of	IN
cord-002410-2zi5iv2t	322	105	type	type	NN
cord-002410-2zi5iv2t	322	106	I	-PRON-	PRP
cord-002410-2zi5iv2t	322	107	and	and	CC
cord-002410-2zi5iv2t	322	108	type	type	NN
cord-002410-2zi5iv2t	322	109	III	iii	CD
cord-002410-2zi5iv2t	322	110	interferons	interferon	NNS
cord-002410-2zi5iv2t	322	111	Hepatitis	Hepatitis	NNP
cord-002410-2zi5iv2t	322	112	C	C	NNP
cord-002410-2zi5iv2t	322	113	virus	virus	NN
cord-002410-2zi5iv2t	322	114	infects	infect	VBZ
cord-002410-2zi5iv2t	322	115	rhesus	rhesu	NNS
cord-002410-2zi5iv2t	322	116	macaque	macaque	NN
cord-002410-2zi5iv2t	322	117	hepatocytes	hepatocyte	NNS
cord-002410-2zi5iv2t	322	118	and	and	CC
cord-002410-2zi5iv2t	322	119	simianized	simianized	JJ
cord-002410-2zi5iv2t	322	120	mice	mouse	NNS
cord-002410-2zi5iv2t	323	1	Hepatic	hepatic	JJ
cord-002410-2zi5iv2t	323	2	cells	cell	NNS
cord-002410-2zi5iv2t	323	3	derived	derive	VBN
cord-002410-2zi5iv2t	323	4	from	from	IN
cord-002410-2zi5iv2t	323	5	induced	induce	VBN
cord-002410-2zi5iv2t	323	6	pluripotent	pluripotent	JJ
cord-002410-2zi5iv2t	323	7	stem	stem	NN
cord-002410-2zi5iv2t	323	8	cells	cell	NNS
cord-002410-2zi5iv2t	323	9	of	of	IN
cord-002410-2zi5iv2t	323	10	pigtail	pigtail	NN
cord-002410-2zi5iv2t	323	11	macaques	macaque	NNS
cord-002410-2zi5iv2t	323	12	support	support	VBP
cord-002410-2zi5iv2t	323	13	hepatitis	hepatitis	NN
cord-002410-2zi5iv2t	323	14	C	C	NNP
cord-002410-2zi5iv2t	323	15	virus	virus	NN
cord-002410-2zi5iv2t	323	16	infection	infection	NN
cord-002410-2zi5iv2t	323	17	Identification	identification	NN
cord-002410-2zi5iv2t	323	18	of	of	IN
cord-002410-2zi5iv2t	323	19	rodent	rodent	NN
cord-002410-2zi5iv2t	323	20	homologs	homolog	NNS
cord-002410-2zi5iv2t	323	21	of	of	IN
cord-002410-2zi5iv2t	323	22	hepatitis	hepatitis	NN
cord-002410-2zi5iv2t	323	23	C	C	NNP
cord-002410-2zi5iv2t	323	24	virus	virus	NN
cord-002410-2zi5iv2t	323	25	and	and	CC
cord-002410-2zi5iv2t	323	26	pegiviruses	pegiviruse	VBZ
cord-002410-2zi5iv2t	323	27	Evidence	evidence	NN
cord-002410-2zi5iv2t	323	28	for	for	IN
cord-002410-2zi5iv2t	323	29	novel	novel	JJ
cord-002410-2zi5iv2t	323	30	hepaciviruses	hepaciviruse	NNS
cord-002410-2zi5iv2t	323	31	in	in	IN
cord-002410-2zi5iv2t	323	32	rodents	rodent	NNS
cord-002410-2zi5iv2t	323	33	Hepatitis	Hepatitis	NNP
cord-002410-2zi5iv2t	323	34	C	C	NNP
cord-002410-2zi5iv2t	323	35	virus	virus	NN
cord-002410-2zi5iv2t	323	36	induces	induce	VBZ
cord-002410-2zi5iv2t	323	37	interferon	interferon	NN
cord-002410-2zi5iv2t	323	38	-	-	:
cord-002410-2zi5iv2t	323	39	and	and	CC
cord-002410-2zi5iv2t	323	40	interferon	interferon	NN
cord-002410-2zi5iv2t	323	41	-	-	HYPH
cord-002410-2zi5iv2t	323	42	stimulated	stimulate	VBN
cord-002410-2zi5iv2t	323	43	genes	gene	NNS
cord-002410-2zi5iv2t	323	44	in	in	IN
cord-002410-2zi5iv2t	323	45	primary	primary	JJ
cord-002410-2zi5iv2t	323	46	liver	liver	NN
cord-002410-2zi5iv2t	323	47	cultures	culture	NNS
cord-002410-2zi5iv2t	323	48	Interferon	Interferon	NNP
cord-002410-2zi5iv2t	323	49	lambda	lambda	NN
cord-002410-2zi5iv2t	323	50	alleles	allele	NNS
cord-002410-2zi5iv2t	323	51	predict	predict	VBP
cord-002410-2zi5iv2t	323	52	innate	innate	JJ
cord-002410-2zi5iv2t	323	53	antiviral	antiviral	JJ
cord-002410-2zi5iv2t	323	54	immune	immune	JJ
cord-002410-2zi5iv2t	323	55	responses	response	NNS
cord-002410-2zi5iv2t	323	56	and	and	CC
cord-002410-2zi5iv2t	323	57	hepatitis	hepatitis	NN
cord-002410-2zi5iv2t	323	58	C	C	NNP
cord-002410-2zi5iv2t	323	59	virus	virus	NN
cord-002410-2zi5iv2t	323	60	permissiveness	permissiveness	NN
cord-002410-2zi5iv2t	323	61	Interferon	Interferon	NNP
cord-002410-2zi5iv2t	323	62	lambda	lambda	NN
cord-002410-2zi5iv2t	323	63	4	4	CD
cord-002410-2zi5iv2t	323	64	expression	expression	NN
cord-002410-2zi5iv2t	323	65	is	be	VBZ
cord-002410-2zi5iv2t	323	66	suppressed	suppress	VBN
cord-002410-2zi5iv2t	323	67	by	by	IN
cord-002410-2zi5iv2t	323	68	the	the	DT
cord-002410-2zi5iv2t	323	69	host	host	NN
cord-002410-2zi5iv2t	323	70	during	during	IN
cord-002410-2zi5iv2t	323	71	viral	viral	JJ
cord-002410-2zi5iv2t	323	72	infection	infection	NN
cord-002410-2zi5iv2t	323	73	Expression	expression	NN
cord-002410-2zi5iv2t	323	74	of	of	IN
cord-002410-2zi5iv2t	323	75	interferon	interferon	NN
cord-002410-2zi5iv2t	323	76	lambda	lambda	NN
cord-002410-2zi5iv2t	323	77	4	4	CD
cord-002410-2zi5iv2t	323	78	is	be	VBZ
cord-002410-2zi5iv2t	323	79	associated	associate	VBN
cord-002410-2zi5iv2t	323	80	with	with	IN
cord-002410-2zi5iv2t	323	81	reduced	reduced	JJ
cord-002410-2zi5iv2t	323	82	proliferation	proliferation	NN
cord-002410-2zi5iv2t	323	83	and	and	CC
cord-002410-2zi5iv2t	323	84	increased	increase	VBN
cord-002410-2zi5iv2t	323	85	cell	cell	NN
cord-002410-2zi5iv2t	323	86	death	death	NN
cord-002410-2zi5iv2t	323	87	in	in	IN
cord-002410-2zi5iv2t	323	88	human	human	JJ
cord-002410-2zi5iv2t	323	89	hepatic	hepatic	JJ
cord-002410-2zi5iv2t	323	90	cells	cell	NNS
cord-002410-2zi5iv2t	323	91	Living	live	VBG
cord-002410-2zi5iv2t	323	92	in	in	IN
cord-002410-2zi5iv2t	323	93	the	the	DT
cord-002410-2zi5iv2t	323	94	liver	liver	NN
cord-002410-2zi5iv2t	323	95	:	:	:
cord-002410-2zi5iv2t	323	96	hepatic	hepatic	JJ
cord-002410-2zi5iv2t	323	97	infections	infection	NNS
cord-002410-2zi5iv2t	323	98	Interferons	interferon	NNS
cord-002410-2zi5iv2t	323	99	and	and	CC
cord-002410-2zi5iv2t	323	100	inhibit	inhibit	VB
cord-002410-2zi5iv2t	323	101	hepatitis	hepatitis	NN
cord-002410-2zi5iv2t	323	102	c	c	NN
cord-002410-2zi5iv2t	323	103	virus	virus	NN
cord-002410-2zi5iv2t	323	104	replication	replication	NN
cord-002410-2zi5iv2t	323	105	with	with	IN
cord-002410-2zi5iv2t	323	106	distinct	distinct	JJ
cord-002410-2zi5iv2t	323	107	signal	signal	NN
cord-002410-2zi5iv2t	323	108	transduction	transduction	NN
cord-002410-2zi5iv2t	323	109	and	and	CC
cord-002410-2zi5iv2t	323	110	gene	gene	NN
cord-002410-2zi5iv2t	323	111	regulation	regulation	NN
cord-002410-2zi5iv2t	323	112	kinetics	kinetics	NN
cord-002410-2zi5iv2t	323	113	Lambda	Lambda	NNP
cord-002410-2zi5iv2t	324	1	interferon	interferon	NNP
cord-002410-2zi5iv2t	324	2	inhibits	inhibit	VBZ
cord-002410-2zi5iv2t	325	1	hepatitis	hepatitis	NNP
cord-002410-2zi5iv2t	325	2	B	B	NNP
cord-002410-2zi5iv2t	325	3	and	and	CC
cord-002410-2zi5iv2t	325	4	C	C	NNP
cord-002410-2zi5iv2t	325	5	virus	virus	NN
cord-002410-2zi5iv2t	325	6	replication	replication	NN
cord-002410-2zi5iv2t	325	7	Transcriptome	Transcriptome	NNP
cord-002410-2zi5iv2t	325	8	analysis	analysis	NN
cord-002410-2zi5iv2t	325	9	reveals	reveal	VBZ
cord-002410-2zi5iv2t	325	10	a	a	DT
cord-002410-2zi5iv2t	325	11	classical	classical	JJ
cord-002410-2zi5iv2t	325	12	interferon	interferon	NN
cord-002410-2zi5iv2t	325	13	signature	signature	NN
cord-002410-2zi5iv2t	325	14	induced	induce	VBN
cord-002410-2zi5iv2t	325	15	by	by	IN
cord-002410-2zi5iv2t	325	16	IFN	IFN	NNP
cord-002410-2zi5iv2t	325	17	4	4	CD
cord-002410-2zi5iv2t	325	18	in	in	IN
cord-002410-2zi5iv2t	325	19	human	human	JJ
cord-002410-2zi5iv2t	325	20	primary	primary	JJ
cord-002410-2zi5iv2t	325	21	cells	cell	NNS
cord-002410-2zi5iv2t	325	22	Engrafted	engraft	VBN
cord-002410-2zi5iv2t	325	23	human	human	JJ
cord-002410-2zi5iv2t	325	24	stem	stem	NN
cord-002410-2zi5iv2t	325	25	cell	cell	NN
cord-002410-2zi5iv2t	325	26	-	-	HYPH
cord-002410-2zi5iv2t	325	27	derived	derive	VBN
cord-002410-2zi5iv2t	325	28	hepatocytes	hepatocyte	NNS
cord-002410-2zi5iv2t	325	29	establish	establish	VBP
cord-002410-2zi5iv2t	325	30	an	an	DT
cord-002410-2zi5iv2t	325	31	infectious	infectious	JJ
cord-002410-2zi5iv2t	325	32	HCV	HCV	NNP
cord-002410-2zi5iv2t	325	33	murine	murine	NN
cord-002410-2zi5iv2t	325	34	model	model	NN
cord-002410-2zi5iv2t	325	35	Productive	productive	JJ
cord-002410-2zi5iv2t	325	36	hepatitis	hepatitis	NN
cord-002410-2zi5iv2t	325	37	C	c	NN
cord-002410-2zi5iv2t	325	38	virus	virus	NN
cord-002410-2zi5iv2t	325	39	infection	infection	NN
cord-002410-2zi5iv2t	325	40	of	of	IN
cord-002410-2zi5iv2t	325	41	stem	stem	NN
cord-002410-2zi5iv2t	325	42	cell	cell	NN
cord-002410-2zi5iv2t	325	43	-	-	HYPH
cord-002410-2zi5iv2t	325	44	derived	derive	VBN
cord-002410-2zi5iv2t	325	45	hepatocytes	hepatocyte	NNS
cord-002410-2zi5iv2t	325	46	reveals	reveal	VBZ
cord-002410-2zi5iv2t	325	47	a	a	DT
cord-002410-2zi5iv2t	325	48	critical	critical	JJ
cord-002410-2zi5iv2t	325	49	transition	transition	NN
cord-002410-2zi5iv2t	325	50	to	to	IN
cord-002410-2zi5iv2t	325	51	viral	viral	JJ
cord-002410-2zi5iv2t	325	52	permissiveness	permissiveness	NN
cord-002410-2zi5iv2t	325	53	during	during	IN
cord-002410-2zi5iv2t	325	54	differentiation	differentiation	NN
cord-002410-2zi5iv2t	325	55	Modeling	model	VBG
cord-002410-2zi5iv2t	325	56	hepatitis	hepatitis	NN
cord-002410-2zi5iv2t	325	57	C	c	NN
cord-002410-2zi5iv2t	325	58	virus	virus	NN
cord-002410-2zi5iv2t	325	59	infection	infection	NN
cord-002410-2zi5iv2t	325	60	using	use	VBG
cord-002410-2zi5iv2t	325	61	human	human	JJ
cord-002410-2zi5iv2t	325	62	induced	induce	VBN
cord-002410-2zi5iv2t	325	63	pluripotent	pluripotent	JJ
cord-002410-2zi5iv2t	325	64	stem	stem	NN
cord-002410-2zi5iv2t	325	65	cells	cell	NNS
cord-002410-2zi5iv2t	325	66	New	new	JJ
cord-002410-2zi5iv2t	325	67	methods	method	NNS
cord-002410-2zi5iv2t	325	68	in	in	IN
cord-002410-2zi5iv2t	325	69	tissue	tissue	NN
cord-002410-2zi5iv2t	325	70	engineering	engineering	NN
cord-002410-2zi5iv2t	325	71	:	:	:
cord-002410-2zi5iv2t	325	72	improved	improve	VBN
cord-002410-2zi5iv2t	325	73	models	model	NNS
cord-002410-2zi5iv2t	325	74	for	for	IN
cord-002410-2zi5iv2t	325	75	viral	viral	JJ
cord-002410-2zi5iv2t	325	76	infection	infection	NN
cord-002410-2zi5iv2t	325	77	25	25	CD
cord-002410-2zi5iv2t	325	78	years	year	NNS
cord-002410-2zi5iv2t	325	79	of	of	IN
cord-002410-2zi5iv2t	325	80	interferon	interferon	NN
cord-002410-2zi5iv2t	325	81	-	-	HYPH
cord-002410-2zi5iv2t	325	82	based	base	VBN
cord-002410-2zi5iv2t	325	83	treatment	treatment	NN
cord-002410-2zi5iv2t	325	84	of	of	IN
cord-002410-2zi5iv2t	325	85	chronic	chronic	JJ
cord-002410-2zi5iv2t	325	86	hepatitis	hepatitis	NN
cord-002410-2zi5iv2t	325	87	C	c	NN
cord-002410-2zi5iv2t	325	88	:	:	:
cord-002410-2zi5iv2t	325	89	an	an	DT
cord-002410-2zi5iv2t	325	90	epoch	epoch	NN
cord-002410-2zi5iv2t	325	91	coming	come	VBG
cord-002410-2zi5iv2t	325	92	to	to	IN
cord-002410-2zi5iv2t	325	93	an	an	DT
cord-002410-2zi5iv2t	325	94	end	end	NN
cord-002410-2zi5iv2t	325	95	Genetic	genetic	JJ
cord-002410-2zi5iv2t	325	96	variation	variation	NN
cord-002410-2zi5iv2t	325	97	in	in	IN
cord-002410-2zi5iv2t	325	98	IL28B	il28b	NN
cord-002410-2zi5iv2t	325	99	and	and	CC
cord-002410-2zi5iv2t	325	100	spontaneous	spontaneous	JJ
cord-002410-2zi5iv2t	325	101	clearance	clearance	NN
cord-002410-2zi5iv2t	325	102	of	of	IN
cord-002410-2zi5iv2t	325	103	hepatitis	hepatitis	NN
cord-002410-2zi5iv2t	325	104	C	C	NNP
cord-002410-2zi5iv2t	325	105	virus	virus	NN
cord-002410-2zi5iv2t	325	106	Genetic	genetic	JJ
cord-002410-2zi5iv2t	325	107	variation	variation	NN
cord-002410-2zi5iv2t	325	108	in	in	IN
cord-002410-2zi5iv2t	325	109	IL28B	il28b	NN
cord-002410-2zi5iv2t	326	1	predicts	predict	VBZ
cord-002410-2zi5iv2t	326	2	hepatitis	hepatitis	NNP
cord-002410-2zi5iv2t	326	3	C	C	NNP
cord-002410-2zi5iv2t	326	4	treatment	treatment	NN
cord-002410-2zi5iv2t	326	5	-	-	HYPH
cord-002410-2zi5iv2t	326	6	induced	induce	VBN
cord-002410-2zi5iv2t	326	7	viral	viral	JJ
cord-002410-2zi5iv2t	326	8	clearance	clearance	NN
cord-002410-2zi5iv2t	326	9	Genetic	genetic	JJ
cord-002410-2zi5iv2t	326	10	variation	variation	NN
cord-002410-2zi5iv2t	326	11	in	in	IN
cord-002410-2zi5iv2t	326	12	IL28B	il28b	NN
cord-002410-2zi5iv2t	326	13	is	be	VBZ
cord-002410-2zi5iv2t	326	14	associated	associate	VBN
cord-002410-2zi5iv2t	326	15	with	with	IN
cord-002410-2zi5iv2t	326	16	chronic	chronic	JJ
cord-002410-2zi5iv2t	326	17	hepatitis	hepatitis	NN
cord-002410-2zi5iv2t	326	18	C	c	NN
cord-002410-2zi5iv2t	326	19	and	and	CC
cord-002410-2zi5iv2t	326	20	treatment	treatment	NN
cord-002410-2zi5iv2t	326	21	failure	failure	NN
cord-002410-2zi5iv2t	326	22	:	:	:
cord-002410-2zi5iv2t	326	23	A	a	DT
cord-002410-2zi5iv2t	326	24	Genome	Genome	NNP
cord-002410-2zi5iv2t	326	25	-	-	HYPH
cord-002410-2zi5iv2t	326	26	Wide	Wide	NNP
cord-002410-2zi5iv2t	326	27	Association	Association	NNP
cord-002410-2zi5iv2t	326	28	Study	Study	NNP
cord-002410-2zi5iv2t	326	29	Genome	Genome	NNP
cord-002410-2zi5iv2t	326	30	-	-	HYPH
cord-002410-2zi5iv2t	326	31	wide	wide	JJ
cord-002410-2zi5iv2t	326	32	association	association	NN
cord-002410-2zi5iv2t	326	33	study	study	NN
cord-002410-2zi5iv2t	326	34	of	of	IN
cord-002410-2zi5iv2t	326	35	spontaneous	spontaneous	JJ
cord-002410-2zi5iv2t	326	36	resolution	resolution	NN
cord-002410-2zi5iv2t	326	37	of	of	IN
cord-002410-2zi5iv2t	326	38	hepatitis	hepatitis	NN
cord-002410-2zi5iv2t	326	39	C	C	NNP
cord-002410-2zi5iv2t	326	40	virus	virus	NN
cord-002410-2zi5iv2t	326	41	infection	infection	NN
cord-002410-2zi5iv2t	326	42	:	:	:
cord-002410-2zi5iv2t	326	43	data	datum	NNS
cord-002410-2zi5iv2t	326	44	from	from	IN
cord-002410-2zi5iv2t	326	45	multiple	multiple	JJ
cord-002410-2zi5iv2t	326	46	cohorts	cohort	NNS
cord-002410-2zi5iv2t	326	47	Genome	Genome	NNP
cord-002410-2zi5iv2t	326	48	-	-	HYPH
cord-002410-2zi5iv2t	326	49	wide	wide	JJ
cord-002410-2zi5iv2t	326	50	association	association	NN
cord-002410-2zi5iv2t	326	51	of	of	IN
cord-002410-2zi5iv2t	326	52	IL28B	IL28B	NNP
cord-002410-2zi5iv2t	326	53	with	with	IN
cord-002410-2zi5iv2t	326	54	response	response	NN
cord-002410-2zi5iv2t	326	55	to	to	IN
cord-002410-2zi5iv2t	326	56	pegylated	pegylated	JJ
cord-002410-2zi5iv2t	326	57	interferonand	interferonand	NNP
cord-002410-2zi5iv2t	326	58	ribavirin	ribavirin	NN
cord-002410-2zi5iv2t	326	59	therapy	therapy	NN
cord-002410-2zi5iv2t	326	60	for	for	IN
cord-002410-2zi5iv2t	326	61	chronic	chronic	JJ
cord-002410-2zi5iv2t	326	62	hepatitis	hepatitis	NN
cord-002410-2zi5iv2t	326	63	C	c	NN
cord-002410-2zi5iv2t	326	64	IL28B	il28b	NN
cord-002410-2zi5iv2t	326	65	expression	expression	NN
cord-002410-2zi5iv2t	326	66	depends	depend	VBZ
cord-002410-2zi5iv2t	326	67	on	on	IN
cord-002410-2zi5iv2t	326	68	a	a	DT
cord-002410-2zi5iv2t	326	69	novel	novel	JJ
cord-002410-2zi5iv2t	326	70	TT/-G	TT/-G	NNP
cord-002410-2zi5iv2t	326	71	polymorphism	polymorphism	NN
cord-002410-2zi5iv2t	326	72	which	which	WDT
cord-002410-2zi5iv2t	326	73	improves	improve	VBZ
cord-002410-2zi5iv2t	326	74	HCV	HCV	NNP
cord-002410-2zi5iv2t	326	75	clearance	clearance	NN
cord-002410-2zi5iv2t	326	76	prediction	prediction	NN
cord-002410-2zi5iv2t	327	1	IL28B	il28b	NN
cord-002410-2zi5iv2t	327	2	polymorphisms	polymorphism	NNS
cord-002410-2zi5iv2t	327	3	predict	predict	VBP
cord-002410-2zi5iv2t	327	4	response	response	NN
cord-002410-2zi5iv2t	327	5	to	to	IN
cord-002410-2zi5iv2t	327	6	therapy	therapy	NN
cord-002410-2zi5iv2t	327	7	among	among	IN
cord-002410-2zi5iv2t	327	8	chronic	chronic	JJ
cord-002410-2zi5iv2t	327	9	hepatitis	hepatitis	NN
cord-002410-2zi5iv2t	327	10	C	c	NN
cord-002410-2zi5iv2t	327	11	patients	patient	NNS
cord-002410-2zi5iv2t	327	12	with	with	IN
cord-002410-2zi5iv2t	327	13	HCV	HCV	NNP
cord-002410-2zi5iv2t	327	14	genotype	genotype	NN
cord-002410-2zi5iv2t	327	15	4	4	CD
cord-002410-2zi5iv2t	328	1	The	the	DT
cord-002410-2zi5iv2t	328	2	favorable	favorable	JJ
cord-002410-2zi5iv2t	328	3	IFNL3	ifnl3	NN
cord-002410-2zi5iv2t	328	4	genotype	genotype	NN
cord-002410-2zi5iv2t	328	5	escapes	escape	VBZ
cord-002410-2zi5iv2t	328	6	mRNA	mRNA	NNP
cord-002410-2zi5iv2t	328	7	decay	decay	NN
cord-002410-2zi5iv2t	328	8	mediated	mediate	VBN
cord-002410-2zi5iv2t	328	9	by	by	IN
cord-002410-2zi5iv2t	328	10	AU	AU	NNP
cord-002410-2zi5iv2t	328	11	-	-	HYPH
cord-002410-2zi5iv2t	328	12	rich	rich	JJ
cord-002410-2zi5iv2t	328	13	elements	element	NNS
cord-002410-2zi5iv2t	328	14	and	and	CC
cord-002410-2zi5iv2t	328	15	hepatitis	hepatitis	NN
cord-002410-2zi5iv2t	328	16	C	C	NNP
cord-002410-2zi5iv2t	328	17	virus	virus	NN
cord-002410-2zi5iv2t	328	18	-	-	HYPH
cord-002410-2zi5iv2t	328	19	induced	induce	VBN
cord-002410-2zi5iv2t	328	20	microRNAs	microrna	NNS
cord-002410-2zi5iv2t	329	1	Interferon	interferon	NN
cord-002410-2zi5iv2t	329	2	signaling	signal	VBG
cord-002410-2zi5iv2t	329	3	and	and	CC
cord-002410-2zi5iv2t	329	4	treatment	treatment	NN
cord-002410-2zi5iv2t	329	5	outcome	outcome	NN
cord-002410-2zi5iv2t	329	6	in	in	IN
cord-002410-2zi5iv2t	329	7	chronic	chronic	JJ
cord-002410-2zi5iv2t	329	8	hepatitis	hepatitis	NN
cord-002410-2zi5iv2t	329	9	C	C	NNP
cord-002410-2zi5iv2t	329	10	Liver	liver	NN
cord-002410-2zi5iv2t	329	11	gene	gene	NN
cord-002410-2zi5iv2t	329	12	expression	expression	NN
cord-002410-2zi5iv2t	329	13	signature	signature	NN
cord-002410-2zi5iv2t	329	14	to	to	TO
cord-002410-2zi5iv2t	329	15	predict	predict	VB
cord-002410-2zi5iv2t	329	16	response	response	NN
cord-002410-2zi5iv2t	329	17	to	to	IN
cord-002410-2zi5iv2t	329	18	pegylated	pegylated	JJ
cord-002410-2zi5iv2t	329	19	interferon	interferon	NN
cord-002410-2zi5iv2t	329	20	plus	plus	CC
cord-002410-2zi5iv2t	329	21	ribavirin	ribavirin	NNP
cord-002410-2zi5iv2t	329	22	combination	combination	NN
cord-002410-2zi5iv2t	329	23	therapy	therapy	NN
cord-002410-2zi5iv2t	329	24	in	in	IN
cord-002410-2zi5iv2t	329	25	patients	patient	NNS
cord-002410-2zi5iv2t	329	26	with	with	IN
cord-002410-2zi5iv2t	329	27	chronic	chronic	JJ
cord-002410-2zi5iv2t	329	28	hepatitis	hepatitis	NN
cord-002410-2zi5iv2t	329	29	C	c	NN
cord-002410-2zi5iv2t	329	30	Hepatic	hepatic	JJ
cord-002410-2zi5iv2t	329	31	gene	gene	NN
cord-002410-2zi5iv2t	329	32	expression	expression	NN
cord-002410-2zi5iv2t	329	33	discriminates	discriminate	VBZ
cord-002410-2zi5iv2t	329	34	responders	responder	NNS
cord-002410-2zi5iv2t	329	35	and	and	CC
cord-002410-2zi5iv2t	329	36	nonresponders	nonresponder	NNS
cord-002410-2zi5iv2t	329	37	in	in	IN
cord-002410-2zi5iv2t	329	38	treatment	treatment	NN
cord-002410-2zi5iv2t	329	39	of	of	IN
cord-002410-2zi5iv2t	329	40	chronic	chronic	JJ
cord-002410-2zi5iv2t	329	41	hepatitis	hepatitis	NN
cord-002410-2zi5iv2t	329	42	C	c	NN
cord-002410-2zi5iv2t	329	43	viral	viral	JJ
cord-002410-2zi5iv2t	329	44	infection	infection	NN
cord-002410-2zi5iv2t	329	45	IL28B	il28b	XX
cord-002410-2zi5iv2t	329	46	in	in	IN
cord-002410-2zi5iv2t	329	47	the	the	DT
cord-002410-2zi5iv2t	329	48	era	era	NN
cord-002410-2zi5iv2t	329	49	of	of	IN
cord-002410-2zi5iv2t	329	50	direct	direct	JJ
cord-002410-2zi5iv2t	329	51	-	-	HYPH
cord-002410-2zi5iv2t	329	52	acting	act	VBG
cord-002410-2zi5iv2t	329	53	antivirals	antiviral	NNS
cord-002410-2zi5iv2t	329	54	for	for	IN
cord-002410-2zi5iv2t	329	55	hepatitis	hepatitis	NN
cord-002410-2zi5iv2t	329	56	C	C	NNP
cord-002410-2zi5iv2t	329	57	Faldaprevir	Faldaprevir	NNP
cord-002410-2zi5iv2t	329	58	and	and	CC
cord-002410-2zi5iv2t	329	59	deleobuvir	deleobuvir	NNS
cord-002410-2zi5iv2t	329	60	for	for	IN
cord-002410-2zi5iv2t	329	61	HCV	HCV	NNP
cord-002410-2zi5iv2t	329	62	genotype	genotype	NN
cord-002410-2zi5iv2t	329	63	1	1	CD
cord-002410-2zi5iv2t	329	64	infection	infection	NN
cord-002410-2zi5iv2t	329	65	IFNL4-ΔG	ifnl4-δg	IN
cord-002410-2zi5iv2t	329	66	genotype	genotype	NN
cord-002410-2zi5iv2t	329	67	is	be	VBZ
cord-002410-2zi5iv2t	329	68	associated	associate	VBN
cord-002410-2zi5iv2t	329	69	with	with	IN
cord-002410-2zi5iv2t	329	70	slower	slow	JJR
cord-002410-2zi5iv2t	329	71	viral	viral	JJ
cord-002410-2zi5iv2t	329	72	clearance	clearance	NN
cord-002410-2zi5iv2t	329	73	in	in	IN
cord-002410-2zi5iv2t	329	74	Hepatitis	Hepatitis	NNP
cord-002410-2zi5iv2t	329	75	C	C	NNP
cord-002410-2zi5iv2t	329	76	,	,	,
cord-002410-2zi5iv2t	329	77	genotype-1	genotype-1	NNP
cord-002410-2zi5iv2t	329	78	patients	patient	NNS
cord-002410-2zi5iv2t	329	79	treated	treat	VBN
cord-002410-2zi5iv2t	329	80	with	with	IN
cord-002410-2zi5iv2t	329	81	sofosbuvir	sofosbuvir	NNP
cord-002410-2zi5iv2t	329	82	and	and	CC
cord-002410-2zi5iv2t	329	83	ribavirin	ribavirin	NNP
cord-002410-2zi5iv2t	329	84	Association	Association	NNP
cord-002410-2zi5iv2t	329	85	of	of	IN
cord-002410-2zi5iv2t	329	86	the	the	DT
cord-002410-2zi5iv2t	329	87	IFNL4-ΔG	IFNL4-ΔG	NNP
cord-002410-2zi5iv2t	329	88	allele	allele	NN
cord-002410-2zi5iv2t	329	89	with	with	IN
cord-002410-2zi5iv2t	329	90	impaired	impaired	JJ
cord-002410-2zi5iv2t	329	91	spontaneous	spontaneous	JJ
cord-002410-2zi5iv2t	329	92	clearance	clearance	NN
cord-002410-2zi5iv2t	329	93	of	of	IN
cord-002410-2zi5iv2t	329	94	hepatitis	hepatitis	NN
cord-002410-2zi5iv2t	329	95	C	C	NNP
cord-002410-2zi5iv2t	329	96	virus	virus	NN
cord-002410-2zi5iv2t	329	97	Gene	Gene	NNP
cord-002410-2zi5iv2t	329	98	-	-	HYPH
cord-002410-2zi5iv2t	329	99	disease	disease	NNP
cord-002410-2zi5iv2t	329	100	association	association	NNP
cord-002410-2zi5iv2t	329	101	with	with	IN
cord-002410-2zi5iv2t	329	102	human	human	JJ
cord-002410-2zi5iv2t	329	103	IFNL	IFNL	NNP
cord-002410-2zi5iv2t	329	104	locus	locus	NN
cord-002410-2zi5iv2t	329	105	polymorphisms	polymorphism	NNS
cord-002410-2zi5iv2t	329	106	extends	extend	VBZ
cord-002410-2zi5iv2t	329	107	beyond	beyond	IN
cord-002410-2zi5iv2t	329	108	hepatitis	hepatitis	NN
cord-002410-2zi5iv2t	329	109	C	C	NNP
cord-002410-2zi5iv2t	329	110	virus	virus	NN
cord-002410-2zi5iv2t	329	111	infections	infection	NNS
cord-002410-2zi5iv2t	329	112	Kinetic	kinetic	JJ
cord-002410-2zi5iv2t	329	113	differences	difference	NNS
cord-002410-2zi5iv2t	329	114	in	in	IN
cord-002410-2zi5iv2t	329	115	the	the	DT
cord-002410-2zi5iv2t	329	116	induction	induction	NN
cord-002410-2zi5iv2t	329	117	of	of	IN
cord-002410-2zi5iv2t	329	118	interferon	interferon	NN
cord-002410-2zi5iv2t	329	119	stimulated	stimulate	VBD
cord-002410-2zi5iv2t	329	120	genes	gene	NNS
cord-002410-2zi5iv2t	329	121	by	by	IN
cord-002410-2zi5iv2t	329	122	interferon	interferon	NN
cord-002410-2zi5iv2t	329	123	-	-	:
cord-002410-2zi5iv2t	329	124	and	and	CC
cord-002410-2zi5iv2t	329	125	interleukin	interleukin	NN
cord-002410-2zi5iv2t	329	126	28B	28b	NN
cord-002410-2zi5iv2t	329	127	are	be	VBP
cord-002410-2zi5iv2t	329	128	altered	alter	VBN
cord-002410-2zi5iv2t	329	129	by	by	IN
cord-002410-2zi5iv2t	329	130	infection	infection	NN
cord-002410-2zi5iv2t	329	131	with	with	IN
cord-002410-2zi5iv2t	329	132	hepatitis	hepatitis	NN
cord-002410-2zi5iv2t	329	133	C	C	NNP
cord-002410-2zi5iv2t	329	134	virus	virus	NN
cord-002410-2zi5iv2t	329	135	Phase	phase	NN
cord-002410-2zi5iv2t	329	136	1b	1b	CD
cord-002410-2zi5iv2t	329	137	study	study	NN
cord-002410-2zi5iv2t	329	138	of	of	IN
cord-002410-2zi5iv2t	329	139	pegylated	pegylated	JJ
cord-002410-2zi5iv2t	329	140	interferon	interferon	NNP
cord-002410-2zi5iv2t	329	141	lambda	lambda	NNP
cord-002410-2zi5iv2t	329	142	1	1	CD
cord-002410-2zi5iv2t	329	143	with	with	IN
cord-002410-2zi5iv2t	329	144	or	or	CC
cord-002410-2zi5iv2t	329	145	without	without	IN
cord-002410-2zi5iv2t	329	146	ribavirin	ribavirin	NN
cord-002410-2zi5iv2t	329	147	in	in	IN
cord-002410-2zi5iv2t	329	148	patients	patient	NNS
cord-002410-2zi5iv2t	329	149	with	with	IN
cord-002410-2zi5iv2t	329	150	chronic	chronic	JJ
cord-002410-2zi5iv2t	329	151	genotype	genotype	NN
cord-002410-2zi5iv2t	329	152	1	1	CD
cord-002410-2zi5iv2t	329	153	hepatitis	hepatitis	NN
cord-002410-2zi5iv2t	329	154	C	c	NN
cord-002410-2zi5iv2t	329	155	virus	virus	NN
cord-002410-2zi5iv2t	329	156	infection	infection	NN
cord-002410-2zi5iv2t	329	157	A	a	DT
cord-002410-2zi5iv2t	329	158	randomized	randomized	JJ
cord-002410-2zi5iv2t	329	159	phase	phase	NN
cord-002410-2zi5iv2t	329	160	2b	2b	CD
cord-002410-2zi5iv2t	329	161	study	study	NN
cord-002410-2zi5iv2t	329	162	of	of	IN
cord-002410-2zi5iv2t	329	163	peginterferon	peginterferon	NNP
cord-002410-2zi5iv2t	329	164	lambda-1a	lambda-1a	NNP
cord-002410-2zi5iv2t	329	165	for	for	IN
cord-002410-2zi5iv2t	329	166	the	the	DT
cord-002410-2zi5iv2t	329	167	treatment	treatment	NN
cord-002410-2zi5iv2t	329	168	of	of	IN
cord-002410-2zi5iv2t	329	169	chronic	chronic	JJ
cord-002410-2zi5iv2t	329	170	HCV	HCV	NNP
cord-002410-2zi5iv2t	329	171	infection	infection	NN
cord-002410-2zi5iv2t	329	172	Peginterferon	Peginterferon	NNP
cord-002410-2zi5iv2t	329	173	lambda-1a	lambda-1a	NNP
cord-002410-2zi5iv2t	329	174	/	/	,
cord-002410-2zi5iv2t	329	175	ribavirin	ribavirin	VBN
cord-002410-2zi5iv2t	329	176	with	with	IN
cord-002410-2zi5iv2t	329	177	daclatasvir	daclatasvir	NNS
cord-002410-2zi5iv2t	329	178	or	or	CC
cord-002410-2zi5iv2t	329	179	peginterferon	peginterferon	JJ
cord-002410-2zi5iv2t	330	1	alfa-2a	alfa-2a	NNP
cord-002410-2zi5iv2t	330	2	/	/	SYM
cord-002410-2zi5iv2t	330	3	ribavirin	ribavirin	RB
cord-002410-2zi5iv2t	330	4	with	with	IN
cord-002410-2zi5iv2t	330	5	telaprevir	telaprevir	NNS
cord-002410-2zi5iv2t	330	6	for	for	IN
cord-002410-2zi5iv2t	330	7	chronic	chronic	JJ
cord-002410-2zi5iv2t	330	8	hepatitis	hepatitis	NN
cord-002410-2zi5iv2t	330	9	C	c	NN
cord-002410-2zi5iv2t	330	10	genotype	genotype	NN
cord-002410-2zi5iv2t	330	11	1b	1b	CD
cord-002410-2zi5iv2t	331	1	A	a	DT
cord-002410-2zi5iv2t	331	2	randomized	randomized	JJ
cord-002410-2zi5iv2t	331	3	study	study	NN
cord-002410-2zi5iv2t	331	4	of	of	IN
cord-002410-2zi5iv2t	331	5	peginterferon	peginterferon	NNP
cord-002410-2zi5iv2t	331	6	lambda-1a	lambda-1a	NNP
cord-002410-2zi5iv2t	331	7	compared	compare	VBN
cord-002410-2zi5iv2t	331	8	to	to	IN
cord-002410-2zi5iv2t	331	9	peginterferon	peginterferon	NNP
cord-002410-2zi5iv2t	332	1	Alfa-2a	Alfa-2a	NNP
cord-002410-2zi5iv2t	332	2	in	in	IN
cord-002410-2zi5iv2t	332	3	combination	combination	NN
cord-002410-2zi5iv2t	332	4	with	with	IN
cord-002410-2zi5iv2t	332	5	Ribavirin	Ribavirin	NNP
cord-002410-2zi5iv2t	332	6	and	and	CC
cord-002410-2zi5iv2t	332	7	telaprevir	telaprevir	NNS
cord-002410-2zi5iv2t	332	8	in	in	IN
cord-002410-2zi5iv2t	332	9	patients	patient	NNS
cord-002410-2zi5iv2t	332	10	with	with	IN
cord-002410-2zi5iv2t	332	11	genotype-1	genotype-1	NNP
cord-002410-2zi5iv2t	332	12	chronic	chronic	JJ
cord-002410-2zi5iv2t	332	13	hepatitis	hepatitis	NN
cord-002410-2zi5iv2t	332	14	C	c	NN
cord-002410-2zi5iv2t	332	15	Design	design	NN
cord-002410-2zi5iv2t	332	16	and	and	CC
cord-002410-2zi5iv2t	332	17	evaluation	evaluation	NN
cord-002410-2zi5iv2t	332	18	of	of	IN
cord-002410-2zi5iv2t	332	19	novel	novel	JJ
cord-002410-2zi5iv2t	332	20	interferon	interferon	NN
cord-002410-2zi5iv2t	332	21	lambda	lambda	NN
cord-002410-2zi5iv2t	332	22	analogs	analog	NNS
cord-002410-2zi5iv2t	332	23	with	with	IN
cord-002410-2zi5iv2t	332	24	enhanced	enhance	VBN
cord-002410-2zi5iv2t	332	25	antiviral	antiviral	JJ
cord-002410-2zi5iv2t	332	26	activity	activity	NN
cord-002410-2zi5iv2t	332	27	and	and	CC
cord-002410-2zi5iv2t	332	28	improved	improved	JJ
cord-002410-2zi5iv2t	332	29	drug	drug	NN
cord-002410-2zi5iv2t	332	30	attributes	attribute	VBZ
cord-002410-2zi5iv2t	332	31	Bringing	bring	VBG
cord-002410-2zi5iv2t	332	32	the	the	DT
cord-002410-2zi5iv2t	332	33	hepatitis	hepatitis	NN
cord-002410-2zi5iv2t	332	34	C	c	NN
cord-002410-2zi5iv2t	332	35	virus	virus	NN
cord-002410-2zi5iv2t	332	36	to	to	IN
cord-002410-2zi5iv2t	332	37	life	life	NN
cord-002410-2zi5iv2t	332	38	Antiviral	antiviral	JJ
cord-002410-2zi5iv2t	332	39	activities	activity	NNS
cord-002410-2zi5iv2t	332	40	of	of	IN
cord-002410-2zi5iv2t	332	41	different	different	JJ
cord-002410-2zi5iv2t	332	42	interferon	interferon	NN
cord-002410-2zi5iv2t	332	43	types	type	NNS
cord-002410-2zi5iv2t	332	44	and	and	CC
cord-002410-2zi5iv2t	332	45	subtypes	subtype	NNS
cord-002410-2zi5iv2t	332	46	against	against	IN
cord-002410-2zi5iv2t	332	47	Hepatitis	Hepatitis	NNP
cord-002410-2zi5iv2t	332	48	E	E	NNP
cord-002410-2zi5iv2t	332	49	virus	virus	NN
cord-002410-2zi5iv2t	332	50	replication	replication	NN
cord-002410-2zi5iv2t	333	1	The	the	DT
cord-002410-2zi5iv2t	333	2	authors	author	NNS
cord-002410-2zi5iv2t	333	3	have	have	VBP
cord-002410-2zi5iv2t	333	4	no	no	DT
cord-002410-2zi5iv2t	333	5	competing	compete	VBG
cord-002410-2zi5iv2t	333	6	interests	interest	NNS
cord-002410-2zi5iv2t	333	7	.	.	.