key: cord-0985001-ratbgibg authors: Barnes, Christopher O.; West, Anthony P.; Huey-Tubman, Kathryn E.; Hoffmann, Magnus A.G.; Sharaf, Naima G.; Hoffman, Pauline R.; Koranda, Nicholas; Gristick, Harry B.; Gaebler, Christian; Muecksch, Frauke; Cetrulo Lorenzi, Julio C.; Finkin, Shlomo; Hägglöf, Thomas; Hurley, Arlene; Millard, Katrina G.; Weisblum, Yiska; Schmidt, Fabian; Hatziioannou, Theodora; Bieniasz, Paul D.; Caskey, Marina; Robbiani, Davide F.; Nussenzweig, Michel C.; Bjorkman, Pamela J. title: Structures of human antibodies bound to SARS-CoV-2 spike reveal common epitopes and recurrent features of antibodies date: 2020-06-24 journal: Cell DOI: 10.1016/j.cell.2020.06.025 sha: a23dd75b617ba129523932a693f6616cf27885ba doc_id: 985001 cord_uid: ratbgibg Summary Neutralizing antibody responses to coronaviruses mainly target the receptor-binding domain (RBD) of the trimeric spike. Here, we characterized polyclonal IgGs and Fabs from COVID-19 convalescent individuals for recognition of coronavirus spikes. Plasma IgGs differed in their focus on RBD epitopes, recognition of alpha- and beta-coronaviruses, and contributions of avidity to increased binding/neutralization of IgGs over Fabs. Using electron microscopy, we examined specificities of polyclonal plasma Fabs, revealing recognition of both S1A and RBD epitopes on SARS-CoV-2 spike. Moreover, a 3.4Å cryo-EM structure of a neutralizing monoclonal Fab-spike complex revealed an epitope that blocks ACE2 receptor binding. Modeling based on these structures suggested different potentials for inter-spike crosslinking by IgGs on viruses and that characterized IgGs would not be affected by identified SARS-CoV-2 spike mutations. Overall, our studies structurally define a recurrent anti-SARS-CoV-2 antibody class derived from VH3-53/VH3-66 and similarity to a SARS-CoV VH3-30 antibody, providing criteria for evaluating vaccine-elicited antibodies. Neutralizing antibody responses to coronaviruses mainly target the receptor-binding domain (RBD) of the trimeric spike. Here, we characterized polyclonal IgGs and Fabs from COVID-19 convalescent individuals for recognition of coronavirus spikes. Plasma IgGs differed in their focus on RBD epitopes, recognition of alpha-and beta-coronaviruses, and contributions of avidity to increased binding/neutralization of IgGs over Fabs. Using electron microscopy, we examined specificities of polyclonal plasma Fabs, revealing recognition of both S1 A and RBD epitopes on SARS-CoV-2 spike. Moreover, a 3.4Å cryo-EM structure of a neutralizing monoclonal Fab-spike complex revealed an epitope that blocks ACE2 receptor binding. Modeling based on these structures suggested different potentials for inter-spike crosslinking by IgGs on viruses and that characterized IgGs would not be affected by identified A newly-emergent betacoronavirus, SARS-CoV-2, resulted in a pandemic in 2020, causing the respiratory disease COVID-19 (Wu et al., 2020b; . SARS-CoV-2 is the third zoonotic betacoronavirus to infect humans this century, following SARS-CoV and MERS-CoV (Middle East Respiratory Syndrome) infections in 2003 and 2012 , respectively (de Wit et al., 2016 . In addition, four globally-distributed human coronaviruses, HCoV-OC43, HCoV-HKU1 (betacoronaviruses), and HCoV-NL63, HCoV-229E (alphacoronaviruses), contribute to 15-30% of common colds (Fung and Liu, 2019) .The neutralizing antibody response to coronaviruses is primarily directed against the trimeric spike glycoprotein (S) on the viral membrane envelope, which serves as the machinery to fuse the viral and host cell membranes (Fung and Liu, 2019) . Coronavirus S proteins contain three copies of an S1 subunit comprising the S1 A through S1 D domains, which mediates attachment to target cells, and three copies of an S2 subunit, which contains the fusion peptide and functions in membrane fusion ( Figure 1A ). Neutralizing antibody responses against SARS-CoV-2, SARS-CoV, and MERS-CoV S proteins often target the receptor-binding domain (RBD; also called the S1 B domain) (Hwang et al., 2006; Pinto et al., 2020; Prabakaran et al., 2006; Reguera et al., 2012; Rockx et al., 2008; Walls et al., 2020; Walls et al., 2019; Widjaja et al., 2019; Wrapp and McLellan, 2019; Wrapp et al., 2020) . The S proteins of SARS-CoV-2 (1273 residues, strain Wuhan-Hu-1) and SARS-CoV (1255 residues, strain Urbani) share 77.5% amino acid sequence identity, while the S proteins of SARS-CoV-2 and MERS-CoV (1353 residues, strain EMC2012) are more distantly related, sharing only 31% identity (Figure 1B, C) . Sequence identities between SARS-CoV-2 and common cold coronavirus S proteins are even lower, varying between 25% and 30%. Phylogenetic analyses confirm that SARS-CoV-2 and SARS-CoV are more closely related to each other than to other human coronaviruses ( Figure 1B ). The RBD/S1 B domains show varying degrees of sequence identity, ranging from 13% (SARS-CoV-2 and HCoV-NL63) to 74% Here, we analyzed purified IgG and Fabs from the plasmas of 10 COVID-19 convalescent individuals (Robbiani et al., 2020) for binding to trimeric S and monomeric RBD/S1 B domains of six human coronaviruses and for neutralization of SARS-CoV-2 pseudoviruses. To better understand recognition by polyclonal antibodies, we further characterized plasma Fabs from two individuals using negative-stain electron microscopy polyclonal epitope mapping (nsEMPEM), showing that the polyclonal landscape includes antibodies that target epitopes in both SARS-CoV-2 S1 A and RBD domains. In addition, we solved a 3.4 Å single-particle cryo-EM structure of an S trimer bound to a neutralizing monoclonal antibody (mAb), which targeted an epitope on an "up" RBD that overlapped with the RBD epitope identified by nsEMPEM and would sterically block ACE2 receptor binding. The epitopes we found represent binding classes defined by distinct VH gene segments, suggesting that these recurring classes are commonly represented in neutralizing antibodies against SARS-CoV-2 and providing criteria for evaluating neutralizing antibodies raised by infection or vaccination. Finally, we used modeling to suggest that distinct binding orientations allow for differential avidity effects, demonstrating the potential for interspike crosslinking that would increase effective affinities for some anti-S IgGs on SARS-CoV-2 virions. coronaviruses and effects of avidity. Convalescent plasma samples were collected from individuals who had recovered from COVID-19 at Rockefeller University Hospital (Robbiani et al., 2020) . We isolated polyclonal IgGs from 10 convalescent plasmas (Figure 2 ), most of which had relatively high neutralizing titers (Robbiani et al., 2020) , and compared binding of their IgGs to purified S proteins from SARS-CoV-2, SARS-CoV, MERS-CoV, HCoV-OC43, HCoV-NL63, and HCoV-229E ( Figure S1 ) by ELISA (Figure 3 ; Figure S2 ). Purified plasma IgGs recognized S proteins from all coronaviruses evaluated, with weaker binding observed for most samples to MERS-CoV ( Figure 3C ) and common cold coronavirus S proteins ( Figure 3D -F). Amongst the plasmas (COV21, COV57, and COV107) chosen for further analysis based on ELISA EC 50 values and neutralization potencies (Robbiani et al., 2020) , IgGs from COV21 and COV57 showed the strongest binding to the S proteins from SARS-CoV-2 and SARS-CoV, with only the ELISAs against RBD (or S1 B domain for two of the common cold coronavirus S proteins) showed the strongest binding to SARS-CoV-2 RBD for COV21, followed by COV57 and then COV107 IgGs, with the proportion of RBD versus S binding from COV21, COV72, and COV47 suggesting that the majority of the IgG responses from these plasmas were focused on the RBD, often a target of neutralizing antibodies in coronavirus infections (Hwang et al., 2006; Pinto et al., 2020; Prabakaran et al., 2006; Reguera et al., 2012; Rockx et al., 2008; Walls et al., 2020; Walls et al., 2019; Widjaja et al., 2019; Wrapp et al., 2020) . The only appreciable reactivity with SARS-CoV or MERS-CoV RBDs was exhibited by COV21 IgG, which bound to SARS-CoV RBD ( Figure 3B ). Although we cannot determine whether the same IgGs are binding all three S proteins, the potential for cross-reactive binding of SARS-CoV antibodies was demonstrated for a mAb that was isolated from a SARS-infected individual, which was shown to recognize SARS-CoV and SARS-CoV-2 RBDs (Pinto et al., 2020) . No reactivity with MERS-CoV RBD was observed for any of the polyclonal IgGs ( Figure 3C ). For most of the plasma IgGs, binding to the RBD was substantially weaker than binding to the counterpart S protein, with the exception of the strong COV21 and COV72 responses to the SARS-CoV-2 RBD. Most of the plasma IgGs exhibited stronger binding to the common cold S1 B /RBDs than to the counterpart S protein trimers ( Figure 3D -F). To assess the degree to which cross-reactive recognition contributed to binding of plasma IgGs to RBD/S1 B domains, we repeated the ELISAs before and after adsorption with SARS-CoV-2 RBD-coupled resin or a control resin for five plasma IgG samples ( Figure S3 ). As a positive control, purified plasma IgGs incubated with the RBD resin showed little or no SARS-CoV-2 RBD binding ( Figure S3A ). Binding to SARS-CoV RBD was also reduced for the IgGs remaining after SARS-CoV-2 RBD adsorption ( Figure S3B) , suggesting cross-reactive recognition consistent with the 78% sequence conservation and structural homology of SARS-CoV-2 RBD and SARS-CoV RBD . By contrast, adsorption of plasma IgGs with SARS-CoV-2 RBD resins had only a modest effect on binding to common cold coronavirus RBDs ( Figure S3D -F), consistent with little to no cross-reactive antibody recognition, likely due to the low conservation between the SARS-CoV-2 RBD and mild coronavirus RBDs (Premkumar et al., 2020) . We also note that IgGs from control plasmas collected from individuals not exposed to SARS-CoV-2 exhibited binding to common cold coronavirus RBDs that was not affected by SARS-CoV-2 RBD adsorption ( Figure S3 ), again consistent with pre-exposure to mild coronaviruses rather than cross-reactivity with SARS-CoV-2 RBD. Taken together, these results suggest: (i) The binding strengths and patterns of different coronavirus S protein recognition were diverse across COVID-19 individual plasma samples, (ii) Convalescent COVID-19 individuals harbor antibodies to the SARS-CoV-2 S protein, and to a lesser extent, the RBD/S1 B , as well as reactivity to other coronaviruses, which likely represents previous exposure to common cold viruses, (iii) Polyclonal IgGs from individual plasma samples that bind to S proteins from MERS-CoV and/or SARS-CoV may display cross-reactive recognition, since the plasma donors were unlikely to have been infected with either of these coronaviruses, and (iv) Compared to the COV57 and COV107 plasmas, the COV21 IgG response had a higher proportion of IgGs that recognized the SARS-CoV-2 RBD. We further evaluated the degree to which avidity effects contributed to the strength of binding of plasma IgGs to S proteins and RBDs by comparing the binding of bivalent polyclonal IgGs to binding of monovalent Fabs prepared by proteolytic cleavage of purified polyclonal IgGs ( Figure 2A -C). Differential effects were evident in IgG to Fab comparisons: most of the SARS-CoV-2 anti-S response was reduced by at least 50% in the case of monovalent Fabs for all plasmas except for COV57 ( Figure 3A ). Recognition of the other coronavirus S proteins was also diminished for Fabs compared to intact IgGs ( Figure 3B -F). For the three plasma IgGs that were further evaluated, the largest relative differences in IgG versus Fab binding to SARS-CoV-2 S protein was observed for COV21 and COV107; the IgG versus Fab binding difference for COV57 was less pronounced ( Figure 3A) . Notably, the SARS-CoV-2 S protein and RBD ELISAs showed that a higher fraction of the COV21 plasma IgGs were RBD-specific compared with the COV57 IgGs ( Figure 3A ,B) (Robbiani et al., 2020) . In summary, the ELISA data indicate that IgGs in plasma samples differ in their degree of focus upon epitopes within the S protein RBD/S1 B domain, their relative amounts of reactivity with SARS-CoV, MERS-CoV, and common cold coronaviruses, and the extent to which avidity effects contribute to the tighter binding of polyclonal bivalent IgGs as compared with monovalent Fabs. Plasma IgGs are more potent neutralizers than plasma Fabs. To investigate whether the bivalent architecture or larger size of IgGs compared with Fabs resulted in increased neutralization potencies, we measured the potencies of purified plasma IgGs and Fabs using in vitro neutralization assays ( Figure 3G ). SARS-CoV-2 pseudoviruses were constructed as described (Robbiani et al., 2020) , and the concentrations of IgGs and Fabs at which 50% neutralization was achieved (IC 50 values) were calculated. All tested plasma IgGs neutralized pseudoviruses at lower molar concentrations than their Fab counterparts, with increased potencies ranging from 6-to 100-fold ( Figure 3H ). The increased potency of the IgGs compared to Fabs was statistically significant (p = 0.0003), even when accounting for two Fabs per IgG. We conclude that bivalent IgGs more effectively neutralize SARS-CoV-2 pseudoviruses than monovalent Fabs. We next used negative stain polyclonal electron microscopy (nsEMPEM) (Bianchi et al., 2018; Nogal et al., 2020) to map epitopes from Fabs isolated from convalescent COVID-19 plasma IgGs onto the SARS-CoV-2 S protein. In this method, Fabs that bind to an antigenic target are separated from non-binding Fabs in a polyclonal mixture by size-exclusion chromatography (SEC), Fab-antigen complexes are imaged by EM, and 2D/3D classification are used to identify predominant epitopes (Bianchi et al., 2018; Nogal et al., 2020) (Figure 2A-C) . Typically, Fabs are incubated at 1000-2000x above EC 50 values calculated from binding assays (Bianchi et al., 2018; Nogal et al., 2020) . For most COVID-19 plasmas, Anti-S Fab EC 50 values were estimated to be >50 µg/mL ( Figure S2 ). Purified polyclonal Fabs from COV21 and COV57 plasmas, which had approximate EC 50 s ranging from 20-50 µg/mL, showed stable binding by SEC after incubation with SARS-CoV-2 S trimers ( Figure 2D ), and 2D class averages showed evidence of bound Fabs ( Figure S4 ). By contrast, purified Fabs from COV107 (EC 50 >50 µg/mL) showed no evidence of binding to S by SEC (data not shown) or in a 3D reconstruction ( Figure 4A ). In order to verify that extra densities in nsEMPEM 3D reconstructions corresponded to bound Fab(s), we first solved a 3D reconstruction of SARS-CoV-2 S alone, revealing the expected low resolution structure of the closed, prefusion S trimer ( Figure 4A ). A 3D reconstruction of COV21 Fabs complexed with S showed recognizable density for the S trimer with a single extending density at the apex of the trimer corresponding to a Fab or mixture of Fabs bound to a similar epitope ( Figure 4A ). The density could be fit to an S trimer with a Fab bound to a single RBD in an "up" position using coordinates from SARS-CoV-2 S trimer structures Wrapp et al., 2020) , consistent with ELISA results mapping the COV21 response to the SARS-CoV-2 RBD ( Figure 3A ). The complex structure and the position of the COV21 Fab(s) closely resembled a structure of SARS-CoV S bound to a Fab from the S230 mAb isolated from a SARS-CoV-infected individual, whose epitope overlaps with the binding site for the ACE2 receptor ( Figure 4B ). Interestingly, S230 binding was shown to functionally mimic ACE2 binding, allowing cleavage of the SARS-CoV S protein to promote fusogenic conformational rearrangements . While the COV21 Fab complex reconstruction showed occupancy for one S-protomer with an RBD in an "up" position ( Figure 4A ), COV21 Fab(s) might also bind analogous to the S230 Fab-SARS-Cov S complex, where classes of S trimer structures were found with two "up"/one "down" and three "up" RBD conformations . Moreover, antibody S230, whose binding orientation resembles the position observed in the COV21 Fab(s) reconstruction ( Figure 4B ), appears to be a member of a class of recurrent anti-SARS mAbs. It belongs to a set of 10 non-clonally-related VH3-30-derived mAbs isolated from an individual infected with SARS-CoV, which represented 40% of the clones isolated from this individual (Pinto et al., 2020) . Notably, these clones contained similar 9 amino acid light chain complementarity determining 3 (CDRL3) sequences (consensus sequence MQGTHWPPT), suggesting that this group of mAbs has a common mode of binding, partially dependent on VH3-30-derived features. RBD residues 473 and 475 contacted by the antibody heavy chain in the S230 Fab-SARS-CoV structure are conserved between SARS-CoV and SARS-CoV-2, and these residues are in the vicinity of antibody heavy chain residues N57 and K58. The only VH gene segments encoding the N57/K58 pair are VH3-30, VH3-30-3, and VH3-33 (Lefranc et al., 2015) . When mAbs were isolated after single B cell sorting using SARS-CoV-also found in sequenced antibodies from five other donor plasmas (Robbiani et al., 2020) . The similarity in binding orientation of COV21 Fab(s) with S230 ( Figure 4B ) suggests that COV21 Fab(s) may be members of the S230 recurrent class. Consistent with this hypothesis, 38 of 127 sequenced antibodies from the COV21 donor were derived from VH3-30 or from the closelyrelated VH3-30-3 or VH3-33 VH gene segments (Robbiani et al., 2020) . The COV57 Fab(s)-S structure also showed recognizable density for both the S trimer and a single bound Fab(s) ( Figure 4C ). However, in this complex, the S trimer appeared closed with no RBDs in an "up" position, and the Fab density was not associated with an RBD, but rather with one of the S1 A subunits. In the complex, the Fab(s) pointed downwards (i.e., towards the viral membrane) rather that upwards (away from the viral membrane), as seen for the COV21 Fab(s). The COV57 Fab(s) density was in the vicinity of loops on the S1 A domain that were disordered in SARS-CoV-2 S trimer structures Wrapp et al., 2020) . Such flexibility could explain the diffuse nature of the COV57 Fab(s) density in this reconstruction. Interestingly, characterization of COV57 neutralization showed less correlation with RBDspecific antibodies relative to COV21 (Robbiani et al., 2020) , consistent with the ELISAs ( Figure 3A ) and nsEMPEM characterizations ( Figure 4C ) reported here. This suggests that targeting S1 regions outside of the RBD may represent alternative modes for potent neutralization of SARS-CoV-2, as found for neutralizing antibodies isolated after vaccination against MERS-CoV in nonhuman primates . Fab(s)-S reconstruction. Although we could not resolve densities for bound Fabs in the COV107-S nsEMPEM reconstruction ( Figure 4A ), RBD-binding mAbs isolated from the COV107 individual were potently neutralizing (Robbiani et al., 2020) . We determined a 3.4 Å singleparticle cryo-EM structure of the complex of one such antibody (C105; IC 50 for neutralization of SARS-CoV-2 pseudovirus = 26.1 ng/mL) (Robbiani et al., 2020) bound to the SARS-CoV-2 S protein using a 1.8 Å crystal structure of the unbound C105 Fab for fitting to the cryo-EM density ( Figure 5 ; Figures S5, S6 , Tables S1,S2). We found two populations of C105 Fab-S complexes: an asymmetric S trimer with two "up" RBDs, each of which was complexed with a Fab (state 1; 3.4 Å resolution), and a symmetric trimer with three RBDs in the same "up" conformation, again with each RBD complexed with a Fab (state 2; 3.7 Å resolution) ( Figure 5A ). A subset of complexes in the cryo-EM structure of the S230 mAb bound to SARS-CoV S trimer were also found with three "up" RBDs bound to three Fabs , although in that structure, as in the C105-S structure, the majority of complexes had their RBDs in a two "up," one "down" configuration. The C105-RBD interfaces were similar across the five examples in the state 1 and state 2 complex structures ( Figure S5 ), thus we describe the interface for one of the Fab-RBD complexes in the state 1 complex in which the resolution at the interface was improved by performing a focused, local refinement (Punjani et al., 2017) on the C105 Fab-RBD portion of the complex ( Figure S5 ). The C105 Fab uses its three heavy chain complementarity determining regions (CDRH1, CDRH2, and CDRH3) and two of its light chain CDRs (CDRL1 and CDRL3) to rest against the receptor-binding ridge of the RBD ( Figure 5B ,C). The majority of the antibody contacts are made by CDRH1, CDRH2, and CDRL1, with CDRH3 and CDRL3 playing minor roles. The C105 epitope overlaps with the COV21 epitope defined by nsEMPEM, which also rests against the receptor-binding ridge in the RBD, although the Fab(s) in the COV21 reconstruction are predicted to adopt a different angle of approach ( Figure 5D ). Interestingly, the C105-RBD interaction closely resembles the RBD interaction of another COVID-19 donor-derived neutralizing mAb, B38 ( Figure 5E ), as reported in a recent Fab-RBD crystal structure (Wu et al., 2020c) . The heavy chains of both B38 and C105 are derived from the VH3-53 gene segment, whereas the light chain gene segments differ: KV1-9 for B38 (Wu et al., 2020c) and LV2-8 for C105 (Robbiani et al., 2020) . Accordingly, the CDRH1 and CDRH2 loops of both neutralizing antibodies share similar conformations and contribute more to the antibody-RBD interface than their CDRH3 loops ( Figure 5B ,E). The common epitope of C105 and B38 overlaps with the binding site for ACE2 ( Figure 5F ), rationalizing their potent neutralizing activities (Robbiani et al., 2020; Wu et al., 2020c) . Given that COV21 was one of the more potent neutralizing plasmas of the 149 that were collected (Robbiani et al., 2020) , the overlap in the C105/B38 neutralizing epitope with the nsEMPEMdefined predominant COV21 epitope suggests that recognition of the COV21 epitope by S230like antibodies would also be neutralizing. 2 RBD neutralizing antibodies. The shared binding mode of C105 and B38, both VH3-53derived mAbs, defines a recurrent class of anti-SARS-CoV-2 mAbs. Among a large set (n=534) of cloned anti-SARS-CoV-2 mAbs against the RBD, those derived from the VH3-53 and VH3-66 gene segments were over-represented (Robbiani et al., 2020) . Other studies have also reported anti-SARS-CoV-2 mAbs derived from these genes (Brouwer et al., 2020; Cao et al., 2020; Chi et al., 2020; Ju et al., 2020; Rogers et al., 2020; Seydoux et al., 2020; Wu et al., 2020c; Zost et al., 2020) . The VH3-53 and VH3-66 VH gene segments encode V regions that differ in only one amino acid position, which is not in a CDR. Thus, they are functionally equivalent in terms of Vgene-determined mAb classes. When grouping VH3-53 and VH3-66, over-representation of VH3-53/VH3-66-derived mAbs is significant (p = 0.035). A notable characteristic of the VH3-53/VH3-66-derived subset (75 mAbs) within the 534 anti-RBD mAbs (Robbiani et al., 2020 ) was a bias towards shorter CDRH3s (as defined by IMGT) (Lefranc et al., 2015) : 75% had lengths between 9 and 12 residues, which is significantly different from the human antibody repertoire and from the entire set of 534 anti-SARS-CoV-2 RBD mAbs (two sample Kolmogorov-Smirnov test, p = 0.017) ( Figure S7A ). Superposition of VH domains from unrelated antibodies with longer CDRH3s suggests that RBD residues 456-457 and/or 484-493 present a steric barrier limiting the CDRH3 loop lengths that are compatible with this binding orientation ( Figure S7B ). A recent report identified a clonallyunrelated group of VH3-53/VH3-66 anti-SARS-CoV-2 mAbs based on CDRH3 sequence similarity to the anti-SARS-CoV mAb m396 (derived from VH1-69) . The structure of a SARS-CoV RDB complex with m396 (PDB code 2DD8) (Prabakaran et al., 2006) shows that mAb m396 does not share the B38/C105 binding mode. We suggest that the key feature of the VH3-53/VH3-66 mAbs identified based on CDRH3 sequence similarity to m396 is their CDRH3 length (11 residues), and that these mAbs will share the C105/B38 binding mode, not the m396 binding mode. Identified S mutations are unlikely to affect epitopes revealed by nsEMPEM and singleparticle cryo-EM. A recent report suggested that a mutation in the S protein (D614G) increases transmissibility of SARS-CoV-2 (Korber et al., 2020) , and it has been speculated that this substitution, or others found in different S protein sequences, could affect antibody recognition. In cryo-EM structures of the prefusion S trimer Wrapp et al., 2020) and in our C105-S complex ( Figure 5 ), S protein residue D614 is located in S1 D , where it makes contact with an adjacent protomer. To address whether the D614G mutation could affect binding of antibodies, we marked the location of the D614 residues and other residues that were reported to mutate (Korber et al., 2020) on the COV21 and COV57 nsEMPEM reconstructions ( Figure 6A ,B) and on the C105-S cryo-EM structure ( Figure 6C ). The RBD-binding COV21 Fab(s) and the C105 Fab are distant from residue D614 ( Figure 6A ,C). Therefore, if the COV21 reconstruction reflects the predominant epitope in the COV21 plasma, it is unlikely that antibodies elicited in the COV21 individual would be sensitive to the D614G substitution. Indeed, in the absence of large conformational changes, all anti-RBD antibodies, including C105 (Robbiani et al., 2020) and B38 (Wu et al., 2020c) , would be unaffected by this substitution. Mutations in the SARS-CoV-2 RBD identified by genome sequencing also include N439K, V483A, and V367F (Tables S3,S4 ), but the affected residues are not within the epitopes of the COV21 Fab(s) ( Figure 6A ,B) or the C105 Fab ( Figure 6C ), and residue 483 is disordered in unliganded S protein structures Wrapp et al., 2020) . The predominant epitope in the COV57 Fab(s) is closer to S protein D614, but this residue appears to be outside of the binding interface. In addition, mutations in the S1 A domain identified by genome sequencing (Tables S3,S4) reside outside of the COV57 Fab(s) epitope ( Figure 6A ,B). Thus in the absence of major conformational changes induced by mutation, the observed substitutions, particularly the D614G mutation, are unlikely to affect antibodies elicited in the COV21 or COV57 individuals or in RBD-binding mAbs such as C105. S protein epitopes offer different possibilities for avidity effects during IgG and receptor binding. IgGs contain two identical antigen-binding Fabs, thus offering the opportunity to bind pathogens with regularly-spaced antigenic sites using avidity effects, either through inter-spike crosslinking (binding the same epitope on adjacent spikes) and/or intra-spike crosslinking (binding the same epitope on identical subunits of a single multimeric spike) (Klein and Bjorkman, 2010) . To address whether inter-spike crosslinking by anti-SARS-CoV-2 IgGs could occur, we modeled adjacent S proteins on a virion membrane assuming a minimum inter-spike separation distance of ~15 nm, as observed from cryo-electron tomography analyses of SARS-CoV and other coronaviruses (Neuman et al., 2011) . By including a bound Fab on each S trimer in the position of the COV21 Fab(s) from the nsEMPEM reconstruction, we addressed whether the Fabs from a single IgG could bind to two adjacent S trimers. The modeling predicts that inter-spike crosslinking could occur for the COV21 epitope ( Figure 7A ). By contrast, the downward-pointing Fab(s) in the COV57-S nsEMPEM reconstruction appear unlikely to participate in inter-spike crosslinking by an IgG due to the Fab orientations being unable to accommodate an Fc in a position that could join two Fabs ( Figure 7A ). These predictions are consistent with ELISA results demonstrating diminished binding for COV21 Fabs compared with their IgG counterparts, but less pronounced differences for the Fab versus IgG comparison for COV57 ( Figure 2 ). We also used modeling to predict whether avidity effects could influence the interaction between ACE2, an integral membrane protein that dimerizes on the target cell surface , with viral S trimers. Starting with a cryo-EM structure of dimeric full-length ACE2 associated with the integral membrane protein B O AT1 bound to monomeric SARS-CoV-2 RBDs , we modeled bound S trimers from a cryo-EM structure of SARS-CoV S trimers with two RBDs in an "up" position (Kirchdoerfer et al., 2018) . Assuming there are adjacent ACE2-B O AT1 complexes in the host cell membrane, the modeling predicts that inter-spike crosslinking is possible ( Figure 7B ). In addition, intra-spike cross-linking could also occur if the RBDs in a two "up"/one "down" S trimer can each rotate ( Figure 7C ). Thus if S trimers can indeed crosslink adjacent ACE2 receptors or bind as a single trimer to both ACE2 subunits in an ACE2 dimer, they could take advantage of avidity effects to bind more tightly than predicted from affinity measurements involving the interactions of monomeric ACE2 ectodomains to monomeric coronavirus RBDs Walls et al., 2020; Wrapp et al., 2020) . The possibility of avidity effects during the interactions of SARS-CoV-2 S with ACE2 dimers has implications for interpretation of pseudovirus assays to measure coronavirus infectivity in the presence and absence of potential inhibitors such as antibodies. In vitro neutralization assays for SARS-CoV-2 include pseudoviruses based on HIV lentiviral particles Crawford et al., 2020; Ou et al., 2020; Robbiani et al., 2020; Wu et al., 2020a) , murine leukemia virus retroviral particles (Pinto et al., 2020; Quinlan et al., 2020) , and vesicular stomatitis virus (Hoffmann et al., 2020; Nie et al., 2020; Xiong et al., 2020) . Each of these pseudovirus types could potentially incorporate different numbers of spikes, in which case the overall spike density would alter sensitivity to antibody avidity. In any case, the effects of avidity on IgG binding to a tethered antigen are a complicated mixture of intrinsic Fab-antigen affinity, kinetics, input concentration, and incubation time (Klein and Bjorkman, 2010; Wu et al., 2005) , thus neutralization potencies of some, but not all, IgGs could be affected in in vitro neutralization assays. In addition, when considering therapeutic applications of convalescent plasma or purified antibodies, avidity effects would be difficult to predict given uncertainties about antibody concentrations, viral titers, and potentially different S trimer spacings and densities on infectious virions. Our results provide a glimpse into diverse antibody responses in neutralizing plasmas from donors who recovered from COVID-19. We characterized polyclonal plasma IgGs that exhibited different degrees of cross-reactive binding between S proteins from SARS-CoV-2, SARS-CoV, and MERS-CoV and showed that the plasma IgGs also included non-cross-reactive antibodies against common cold virus RBDs. By mapping SARS-CoV-2 S epitopes targeted by convalescent plasma IgGs, we not only observed the expected targeting of the S protein RBD, but also discovered an S1 A epitope outside of the RBD, which may represent an alternative binding site for neutralizing antibodies. The RBD-binding Fab(s) from COV21 plasma resembled binding of S230, a VH3-30 mAb isolated from a SARS-CoV patient that blocks ACE2 receptor binding (Rockx et al., 2008) . We found another type of ACE2 receptor-blocking anti-SARS-CoV-2 antibody in our analysis of a neutralizing mAb derived from the COV107 individual. In a 3.4 cryo-EM structure of the SARS-CoV-2 S protein bound to the C105 mAb, we observed an epitope on the RBD that overlapped with the binding site for COV21 Fab(s) and closely resembled the binding of B38, another mAb isolated from a COVID-19 patient (Wu et al., 2020c) . Like C105, B38 is also derived from the VH3-53 VH gene segment. Our structural studies support the hypothesis that recurrent classes of anti-SARS-CoV-2 neutralizing antibodies derived from the VH3-53/VH3-66 and VH3-30 gene segments use the distinct RBD-binding modes of the B38/C105 and S230 mAbs, respectively, providing valuable information for evaluating antibodies raised by infection or vaccination by sequences alone. Finally, the RBD and S1 A epitopes we mapped by nsEMPEM and singleparticle cryo-EM are unlikely to be affected by common mutations in different SARS-CoV-2 isolates, offering hope that antibody therapeutics and/or a vaccine might be effective in combatting the current pandemic. wrote the paper with contributions from other authors. In connection with this work, The Rockefeller University has filed a provisional patent application on which D.F.R. and M.C.N. are inventors. (Goddard et al., 2007; Pettersen et al., 2004) , displayed as cartoons (S1 A : blue, S1 B : red, S2: gray). (B) For COV21, the volume was best-fitted with PDB 6VYB (SARS-CoV-2, one "up" S1 B conformation, inset). Overlay of PDB 6NB6 showed similarities in S1 B epitope targeting of COV21 Fab (orange) and the human SARS-CoV neutralizing antibody, S230 (magenta, cartoon). (C) COV57 was fitted with PDB 6VXX (closed, prefusion conformation, inset). Fab density (green) was focused on the S1 A domain. See also Figure S4 . plasmas (indicated by numbers) and control plasmas (indicated as "con") were adsorbed with one of two resins: a SARS-CoV-2 RBD resin (IgGs remaining after RBD adsorption; light gray bars) and a 2G12 mAb control resin (IgGs remaining after control adsorption; dark gray bars). IgGs remaining after adsorption were evaluated in ELISAs against the indicated RBD (or S1 B ) domains. Binding of IgGs after adsorption to IOMA, an antibody against HIV-1 (Gristick et al., 2016) , was used as a control in each assay. Results are presented as area under the curve (AUC; shown as mean and ± S.D. of experiments conducted in duplicate). Workflow for classification and refinement of selected particles. Briefly, after selection of good 2D class averages, an ab initio model was generated, which was then homogeneously refined before further 3D classification. To improve features at the SARS-CoV-2 RBD-C105 Fab interface, particles from states 1 and 2 were combined and used for non-uniform, focused refinement to yield a state 1-like reconstruction to an FSC=0.143 resolution of 3.4 Å. (Wu et al., 2020c) . In cases in which there was more than one Fab in the crystallographic asymmetric unit, each VH was evaluated and enumerated separately. CDRH3 clashes were defined if any CDRH3 atom was within 2.0 Å of an atom in the RBD, a stringent criterion devised to account for not allowing CDR flexibility or different side chain rotamer conformations. Further information and requests for reagents should be directed to and will be fulfilled by the Lead Contact, Pamela Bjorkman (bjorkman@caltech.edu). Expression plasmids generated in this study for human CoV proteins and the C105 Fab will be shared upon request. Unique reagents generated in this study (purified human plasma IgGs and SARS-CoV-2 pseudoviruses) are available from the Lead Contact with a completed Material Transfer Agreement. Table S4 . Samples of peripheral blood were obtained upon written consent from community participants under protocols approved by the Institutional Review Board of the Rockefeller University (DRO-1006). Details on the demographics of the cohort are provided in (Robbiani et al., 2020) . HEK293T cells for pseudovirus production and HEK293T ACE2 cells for pseudovirus neutralization experiments were cultured at 37°C and 5% CO 2 in Dulbecco's modified Eagle's medium (DMEM, Gibco) supplemented with 10% heat-inactivated fetal bovine serum (FBS, Sigma-Aldrich) and 5 µg/ml Gentamicin (Sigma-Aldrich). The medium for the 293T Ace2 cells additionally contained 5µg/ml Blasticidin (Gibco). For constitutive expression of ACE2 in 293T cells, a cDNA encoding ACE2, carrying two inactivating mutations in the catalytic site (H374N & H378N) , was inserted into CSIB (Kane et al., 2016) 3' to the SFFV promoter (Robbiani et al., 2020) . 293T ACE2 cells were generated by transduction with CSIB based virus followed by selection with 5 µg/ml Blasticidin (Gibco). Expi293F cells (Gibco) for protein expression were maintained at 37°C and 8% CO 2 in Expi293 Expression medium (Gibco), transfected using Expi293 Expression System Kit (Gibco) and maintained under shaking at 130 rpm. The gender of the HEK293T, HEK293T ACE2 and Expi293F cell lines is female. Cell lines were not specifically authenticated. E. coli DH5 Alpha (Zymo Research) for propagation of expression plasmids were cultured at 37˚C in LB broth (Sigma-Aldrich) with shaking at 250 rpm. To generate pseudotyped viral stocks, HEK293T cells were transfected with pNL4-3∆Envnanoluc and pSARS-CoV2-S trunc (Robbiani et al., 2020) using polyethylenimine, leading to production of HIV-1-based virions carrying the SARS-CoV-2 S protein at the surface. Eight hours after transfection, cells were washed twice with phosphate buffered saline (PBS) and fresh media was added. Supernatants containing virions were harvested 48 hours post transfection, filtered and stored at -80°C. Infectivity of virions was determined by titration on 293T ACE2 cells. Convalescent and healthy donor plasma samples were collected and processed as described (Robbiani et al., 2020) . The convalescent plasma samples used for nsEMPEM were from residents in the State of New York: COV21 (a 54-year-old male Hispanic, collection 27 days after symptom onset), COV57 (a 66-year-old male Caucasian, collection 21 days after symptom onset), and COV107 (a 53-year-old female Caucasian, collection 29 days after symptom onset). An analysis of SARS-CoV-2 genomes in the GISAID database with sample collection dates in March 2020 (contemporaneous with the infections of individuals COV21, COV57, and COV107) was performed to identify any viral spike mutations likely to have been present. For SARS-CoV-2 genomes of New York State residents from March 2020, 468 of 475 contained the D614G mutation. Thus, based on state-level mutant frequencies, these individuals were likely to have been infected with D614G-containing viruses. All other spike mutations in these genomes had a frequency below 2%. All participants provided written informed consent before sample collection at the Rockefeller University Hospital and the study was conducted in accordance with Good Clinical Practice. Anti-coagulated plasma was heat-inactivated (56˚C for 1 hour) prior to shipment to Caltech and stored at 4˚C thereafter (Robbiani et al., 2020) . Sequence alignments of S proteins and RBD/S1 B domains were made with Clustal Omega (Sievers et al., 2011) . Phylogenetic trees were calculated from these amino acid alignments using PhyML 3.0 (Guindon et al., 2010) and visualized with PRESTO (http://www.atgcmontpellier.fr/presto). Codon-optimized nucleotide sequences encoding the SARS-CoV-2 S ectodomain (residues 16-1206 of an early SARS-CoV-2 sequence isolate; GenBank MN985325.1, which has an Asp at position 614, so does not include the D614G mutation described as possibly more transmissible in (Korber et al., 2020) ), SARS-CoV S (residues 12-1193; GenBank AAP13441.1), MERS-CoV S (residues 19-1294; GenBank JX869059.2), HCoV-OC43 (residues 15-1263; GenBank AAT84362.1), HCoV-NL63 (residues 16-1291; GenBank AAS58177.1), and HCoV-229E (residues 17-1113; GenBank AAK32191.1) were synthesized and subcloned into the mammalian expression pTwist-CMV BetaGlobin vector by Twist Bioscience Technologies. The S proteins were modified as previously described . Briefly, the S ectodomain constructs included an N-terminal mu-phosphatase signal peptide, 2P stabilizing mutations (Pallesen et al., 2017) and a C-terminal extension (GSG-RENLYFQG (TEV protease site), GGGSG-YIPEAPRDGQAYVRKDGEWVLLSTFL (foldon trimerization motif), G-HHHHHHHH (octa-histidine tag), and GLNDIFEAQKIEWHE (AviTag)). For SARS-CoV-2, MERS-CoV, HCoV-NL63 and HCoV-OC43 mutations to remove the S1/S2 furin cleavage site were introduced. Codon-optimized nucleotide sequences encoding the receptor binding domain (RBD) for SARS-CoV-2 (residues 331-524) SARS-CoV S (residues 318-510), MERS-CoV S (residues 367-588), HCoV-NL63 (residues 481-614), and corresponding S1 B domains for HCoV-OC43 (residues 324-632), and HCoV-229E (residues 286-434) were synthesized and subcloned into the mammalian expression pTwist-CMV BetaGlobin vector by Twist Bioscience Technologies. The RBD/S1 B constructs included an N-terminal human IL-2 signal peptide and dual C-terminal tags (G-HHHHHHHH (octa-histidine), and GLNDIFEAQKIEWHE (AviTag)). The S protein and RBD/S1 analyzed by SDS-PAGE, and fractions corresponding to S trimers or monomeric RBD/S1 B proteins were pooled and stored at 4˚C. Purified CoV-S trimers were concentrated to 1 mg/mL and loaded onto a Superose 6 Increase 10/300 GL column (GE Healthcare Life Sciences) and passed through a Wyatt DAWN coupled to a Wyatt UT-rEX differential refractive index detector (Wyatt Technology). Data were analyzed using Astra 6 software (Wyatt Technology) to determine glycoprotein molecular weights. IgGs were purified from plasma samples using 5- Plasmids for SARS-CoV-2 RBD 6xHisTag constructs (residues 319-541, GenBank: protocol. Control resin was made using the same procedure to covalently couple 2G12, an HIV-1 mAb, as described (Scharf et al., 2015) . For RBD-absorption ELISA experiments to evaluate binding of purified polyclonal IgGs to CoV S1 B /RBD proteins after absorption of SARS-CoV-2 RBD-specific antibodies, biotinylated-S1 B /RBD proteins were captured on high-capacity streptavidin coated 96-well plates (Thermo Scientific) by incubating with 100 µL of 2 µg/mL protein solution in TBS overnight at 4˚C. Plates were washed 3x in washing buffer and blocked as described above. For absorption of RBDspecific antibodies, 100 µL of SARS-CoV-2 RBD-coupled resin or 2G12 control resin was incubated with 100 µL of purified IgGs diluted to ~1 mg/mL for 1 h at RT with agitation. After incubation, SARS-CoV-2 RBD-coupled resin was gently centrifuged at 250 x g for 2 min, and non-absorbed IgGs were removed by careful pipetting of the aqueous layer above the pelleted RBD-coupled resin. Unadsorbed and absorbed IgG samples were assayed at a 50 µg/mL starting concentration and seven 4-fold serial dilutions as described above. Pseudoviruses based on HIV lentiviral particles were prepared as described (Robbiani et al., 2020 Purified CoV-S trimers were adsorbed to freshly-glow discharged PureC 300 mesh carboncoated copper grids (EMD Sciences) for 1 min followed by 2% uranyl formate (Electron Microscopy Sciences) staining. Micrographs were recorded using Digital Micrograph software on a 120kV FEI Tecnai T12 equipped with a Gatan Ultrascan 2k X 2k CCD at a 52,000x nominal magnification. Methods were adapted from (Bianchi et al., 2018) . To form polyclonal Fab-S complexes, 30 µg of SARS-CoV-2 S trimers were incubated overnight at RT with 30-50 mg/mL Fabs in 100 µL total volume (corresponding to ~1000x the EC 50 values for ELISAs using purified polyclonal Fabs), and the complexes were purified by SEC on a Superose 6 increase 10/300 GL column (GE Healthcare Life Sciences). Fractions containing complexes were pooled and concentrated to 50 µg/mL and passed through a 0.1 µm filter before deposition on 300 mesh carbon-coated copper grids (Ted Pella) and stained with 1% (w/v) uranyl formate (Electron Microscopy Sciences). Grids were imaged at 300 keV using a Titan Krios transmission electron microscope (Thermo Fisher) operating at RT, equipped with a K3 direct electron detector (Gatan) using SerialEM 3.7 (Mastronarde, 2005) . Images were processed in cryoSPARC v 2.14, and a reference-free particle stack was generated using a Gaussian blob picker (Punjani et al., 2017) . Particles corresponding to S-Fab complexes were identified by extensive 2D classification to identify class averages that displayed structural elements interpreted as Fab density and also represented different views. Extracted particles were used to generate ab initio models in cryoSPARC that were further processed by 3D classification to separate out complexes and S trimer structures alone. Figures were prepared using UCSF Chimera (Goddard et al., 2007; Pettersen et al., 2004) . The Fab from the C105 monoclonal IgG was expressed, purified, and stored as described (Scharf et al., 2015; Schoofs et al., 2019 (Adams et al., 2010) and cycles of manual building in Coot (Emsley et al., 2010) ( Table S1 ). Purified C105 Fab was incubated with SARS-CoV-2 S trimer at a 2:1 molar ratio per protomer on ice for 30 minutes prior to purification by SEC on a Superose 6 Increase 10/300 GL column (GE Healthcare Life Sciences). Fab-S complexes were concentrated to 1.6 mg/ml in Trisbuffered saline (TBS). Immediately before deposition onto a 300 mesh, 1.2/1.3 AuUltraFoil grid (Electron Microscopy Sciences) that had been freshly glow-discharged for 1 min at 20 mA using a PELCO easiGLOW (Ted Pella), 3 µL of complex was mixed with 0.5 µL of a 0.5% w/v octylmaltoside, fluorinated solution (Anatrace). Samples were vitrified in 100% liquid ethane using a Mark IV Vitrobot (Thermo Fisher) after blotting for 3 s with Whatman No. 1 filter paper at 22°C and 100% humidity. For the C105-S trimer complex, micrographs were collected on a Titan Krios transmission electron microscope (Thermo Fisher) operating at 300 kV using SerialEM automated data collection software (Mastronarde, 2005) . Movies were obtained on a Gatan K3 Summit direct electron detector operating in counting mode at a nominal magnification of 105,000x (superresolution 0.418 Å/pixel) using a defocus range of −1 to −2.5 µm. Movies were collected with an 1.9 s exposure time with a rate of 22 e -/pix/s, which resulted in a total dose of ~60 e-/Å 2 over 40 frames. The 5,940 cryo-EM movies were patch motion corrected for beam-induced motion including dose-weighting within cryoSPARC v2.15 (Punjani et al., 2017) after binning super resolution movies by 2 (0.836 Å/pixel). The non-dose-weighted images were used to estimate CTF parameters using CTFFIND4 (Rohou and Grigorieff, 2015) , and micrographs with power spectra that showed poor CTF fits or signs of crystalline ice were discarded, leaving 5,316 micrographs. Particles were picked in a reference-free manner using Gaussian blob picker in cryoSPARC (Punjani et al., 2017) . An initial 565,939 particle stack was extracted, binned x2 (1.68 Å/pixel), and subjected to iterative rounds of reference-free 2D classification to identify class averages corresponding to intact S-trimer complexes with well-defined structural features. This routine resulted in a new particle stack of 71,289 particles, which were unbinned (0.836 Å/pixel) and re-extracted using a 352 box size. Two ab initio volumes were generated, with one class of 61,737 particles revealing an S-trimer complexed with two C105 Fabs. Particles were further 3D classified (k=3) and heterogeneously refined to reveal two distinct states of the C105-S trimer complex. State 1 (37,615 particles) displaying 2 "up" RBD conformations bound by 2 C105 Fabs, and state 2 (14,119 particles) that displayed 3 "up" RBD conformations bound by 3 C105 Fabs. Particles from states 1 and 2 were separately refined using non-uniform 3D refinement imposing either C1 or C3 symmetry, respectively, to final resolutions of 3.6 Å (state 1; 37,615 particles) and 3.7 Å (state 2; 14,119 particles) according to the gold-standard FSC (Bell et al., 2016) . Given that the RBD "up" conformations with C105 Fabs bound were similar in both states 1 and 2, improvements to the resolution at the RBD-C105 Fab interface were achieved by combining the entire particle stack (~52k particles) for a focused, non-uniform 3D refinement. A soft mask was generated from the state 1 volume (5pixel extension, 10-pixel soft cosine edge) for the S1 subunits and C105 Fab variable domains. These efforts resulted in a modest improvement in the RBD-C105 Fab interface ( Figure S6D ), and an overall resolution of 3.4 Å according to the gold-standard FSC. Initial coordinates were generated by docking individual chains from reference structures into cryo-EM density using UCSF Chimera (Goddard et al., 2007) . The following coordinates were used: SARS-CoV-2 S trimer: PDB code 6VYB, "up" RBD conformations: PDB code 7BZ5, C105 Fab: this study. These initial models were then refined into cryo-EM maps using one round of rigid body refinement followed by real space refinement. Sequence-updated models were built manually in Coot (Emsley et al., 2010) and then refined using iterative rounds of refinement in Coot and Phenix (Adams et al., 2010) . Glycans were modeled at possible N-linked glycosylation sites (PNGSs) in Coot using 'blurred' maps processed with a variety of B-factors (Terwilliger et al., 2018 ). Validation of model coordinates was performed using MolProbity and is reported in Table S3 . Structural figures were made using PyMOL (Version 1.8.2.1 Schrodinger, LLC) or UCSF Chimera (Goddard et al., 2007) . Local resolution maps were calculated using cryoSPARC v 2.15 (Punjani et al., 2017) . For ELISAs to evaluate plasma IgG binding to human CoV proteins, the average signals from independent experiments were plotted as area under the curve (AUC) using MatLab R2019a (MathWorks). The number of replicates for each experiment is described in the figure or table legends. Statistical significance was defined as p < 0.05. The comparison of the neutralization potencies of plasma IgGs and Fabs (n=12) was performed using a two-tailed paired t-test. The frequency of VH3-53/VH3-66 gene usage among the cloned anti-SARS-CoV-2 mAbs in 6 individuals was compared to human repertoire V gene usage using a two-tailed t-test with unequal variances as described (Robbiani et al., 2020) . The two-sample Kolmogorov-Smirnov test to compare the CDRH3 length distribution of VH3-53 and VH3-66 mAbs (together) with the 534 set or the human repertoire was performed using the Quest Graph™ Kolmogorov-Smirnov (K-S) Test Calculator, AAT Bioquest, Inc, https://www.aatbio.com/tools/kolmogorov-smirnov-k-stest-calculator. The VH3-53/VH3-66 CDRH3 length comparison with the 534 set was also evaluated using the two-tailed Mann-Whitney U test, which indicated p < 0.001. Tables Table S1 . Crystallographic data collection and refinement statistics for C105 Fab structure (related to Figure 5 ). (12-1, SSRL Unit cell (Å) Table S2 . Cryo-EM data collection and refinement statistics for C105-S complex structure (related to Figure 5 ). Table S3 . S protein mutations found in different SARS-CoV-2 isolates (related to Figure 6 ). List of SARS-CoV-2 spike mutations with a frequency ≥ 0.1% in a set of 15335 isolates downloaded from the Global Initiative for Sharing All Influenza Data (GISAID) SARS-CoV-2 sequence database on 5/3/20 (Elbe and Buckland-Merrett, 2017; Shu and McCauley, 2017) . The genomes were processed with the nextstrain augur pipeline (https://github.com/nextstrain/augur) (Hadfield et al., 2018) , using MAFFT v7.464 (Katoh and Standley, 2013) for sequence alignment and FastTree (Price et al., 2010) to generate a phylogenetic tree. The resulting data were then analyzed with a custom Swift program. Supplemental Table 3 . S protein mutations found in different SARS-CoV-2 isolates. List of SARS-CoV-2 spike mutations with a frequency ≥ 0.1% in a set of 15335 isolates downloaded from GISAID on 5/3/20. PHENIX: a comprehensive Python-based system for macromolecular structure solution High resolution single particle refinement in EMAN2 Electron-Microscopy-Based Epitope Mapping Defines Specificities of Polyclonal Antibodies Elicited during HIV-1 BG505 Envelope Trimer Immunization Commonality despite exceptional diversity in the baseline human antibody repertoire Potent neutralizing antibodies from COVID-19 patients define multiple targets of vulnerability Potent neutralizing antibodies against SARS-CoV-2 identified by high-throughput single-cell sequencing of convalescent patients' B cells MolProbity: all-atom structure validation for macromolecular crystallography Human monoclonal antibodies block the binding of SARS-CoV-2 Spike protein to angiotensin converting enzyme 2 A potent neutralizing human antibody reveals the N-terminal domain of the Spike protein of SARS-CoV-2 as a site of vulnerability Protocol and Reagents for Pseudotyping Lentiviral Particles with SARS-CoV-2 Spike Protein for Neutralization Assays SAbDab: the structural antibody database Data, disease and diplomacy: GISAID's innovative contribution to global health Features and development of Coot Human Coronavirus: Host-Pathogen Interaction Visualizing density maps with UCSF Chimera A decade after SARS: strategies for controlling emerging coronaviruses Molecular pathology of emerging coronavirus infections Natively glycosylated HIV-1 Env structure reveals new mode for antibody recognition of the CD4-binding site Cryo-electron microscopy structures of the SARS-CoV spike glycoprotein reveal a prerequisite conformational state for receptor binding New algorithms and methods to estimate maximum-likelihood phylogenies: assessing the performance of PhyML 3.0 Nextstrain: real-time tracking of pathogen evolution SARS-CoV-2 Cell Entry Depends on ACE2 and TMPRSS2 and Is Blocked by a Clinically Proven Protease Inhibitor Structural basis of neutralization by a human anti-severe acute respiratory syndrome spike protein antibody, 80R Potent human neutralizing antibodies elicited 1 by SARS-CoV-2 infection Identification of Interferon-Stimulated Genes with Antiretroviral Activity MAFFT multiple sequence alignment software version 7: improvements in performance and usability Structure and immune recognition of the porcine epidemic diarrhea virus spike protein Pre-fusion structure of a human coronavirus spike protein Stabilized coronavirus spikes are resistant to conformational changes induced by receptor recognition or proteolysis Few and far between: how HIV may be evading antibody avidity Spike mutation pipeline reveals the emergence of a more transmissible form of SARS-CoV-2 IMGT(R), the international ImMunoGeneTics information system(R) 25 years on Angiotensin-converting enzyme 2 is a functional receptor for the SARS coronavirus The human coronavirus HCoV-229E S-protein structure and receptor binding Automated electron microscope tomography using robust prediction of specimen movements Phaser crystallographic software A structural analysis of M protein in coronavirus assembly and morphology Establishment and validation of a pseudovirus neutralization assay for SARS-CoV-2 Mapping Polyclonal Antibody Responses in Non-human Primates Vaccinated with HIV Env Trimer Subunit Vaccines Characterization of spike glycoprotein of SARS-CoV-2 on virus entry and its immune crossreactivity with SARS-CoV Immunogenicity and structures of a rationally designed prefusion MERS-CoV spike antigen UCSF Chimera--a visualization system for exploratory research and analysis Structural and functional analysis of a potent sarbecovirus neutralizing antibody Immunologic correlates of protection induced by vaccination Vaccines: correlates of vaccine-induced immunity Correlates of protection induced by vaccination Structure of severe acute respiratory syndrome coronavirus receptor-binding domain complexed with neutralizing antibody The RBD Of The Spike Protein Of SARS-Group Coronaviruses Is A Highly Specific Target Of SARS-CoV-2 Antibodies But Not Other Pathogenic Human and Animal Coronavirus Antibodies FastTree 2--approximately maximum-likelihood trees for large alignments cryoSPARC: algorithms for rapid unsupervised cryo-EM structure determination The SARS-CoV-2 receptor-binding domain elicits a potent neutralizing response without antibody dependent enhancement Dipeptidyl peptidase 4 is a functional receptor for the emerging human coronavirus-EMC Structural bases of coronavirus attachment to host aminopeptidase N and its inhibition by neutralizing antibodies Convergent Antibody Responses to SARS-CoV-2 Infection in Convalescent Individuals Structural basis for potent cross-neutralizing human monoclonal antibody protection against lethal human and zoonotic severe acute respiratory syndrome coronavirus challenge Rapid isolation of potent SARS-CoV-2 neutralizing antibodies and protection in a small animal model Broadly Neutralizing Antibody 8ANC195 Recognizes Closed and Open States of HIV-1 Env Broad and Potent Neutralizing Antibodies Recognize the Silent Face of the HIV Envelope Characterization of neutralizing antibodies 1 from a SARS-CoV-2 infected individual Structural basis of receptor recognition by SARS-CoV-2 Cryo-Electron Microscopy Structure of Porcine Deltacoronavirus Spike Protein in the Prefusion State GISAID: Global initiative on sharing all influenza data -from vision to reality Fast, scalable generation of high-quality protein multiple sequence alignments using Clustal Omega A fully automatic method yielding initial models from high-resolution cryo-electron microscopy maps Structural insights into coronavirus entry Structural basis for human coronavirus attachment to sialic acid receptors Function, and Antigenicity of the SARS-CoV-2 Spike Glycoprotein Cryo-electron microscopy structure of a coronavirus spike glycoprotein trimer Tectonic conformational changes of a coronavirus spike glycoprotein promote membrane fusion Unexpected Receptor Functional Mimicry Elucidates Activation of Coronavirus Fusion Receptor Recognition by the Novel Coronavirus from Wuhan: an Analysis Based on Decade-Long Structural Studies of SARS Coronavirus A human monoclonal antibody blocking SARS-CoV-2 infection Evaluation of candidate vaccine approaches for MERS-CoV Towards a solution to MERS: protective human monoclonal antibodies targeting different domains and functions of the MERScoronavirus spike glycoprotein Overview of the CCP4 suite and current developments The 3.1-Angstrom Cryo-electron Microscopy Structure of the Porcine Epidemic Diarrhea Virus Spike Protein in the Prefusion Conformation Cryo-EM structure of the 2019-nCoV spike in the prefusion conformation Neutralizing antibody responses to SARS-CoV-2 in a COVID-19 recovered patient cohort and their implications A new coronavirus associated with human respiratory disease in China Ultra-potent antibodies against respiratory syncytial virus: effects of binding kinetics and binding valence on viral neutralization A noncompeting pair of human neutralizing antibodies block COVID-19 virus binding to its receptor ACE2 Robust neutralization assay based on SARS-CoV-2 S-bearing vesicular stomatitis virus (VSV) pseudovirus and ACE2-overexpressed BHK21 cells Glycan Shield and Fusion Activation of a Deltacoronavirus Spike Glycoprotein Fine-Tuned for Enteric Infections Structural basis for the recognition of SARS-CoV-2 by full-length human ACE2 A highly conserved cryptic epitope in the receptor-binding domains of SARS-CoV-2 and SARS-CoV Cryo-EM structures of MERS-CoV and SARS-CoV spike glycoproteins reveal the dynamic receptor binding domains Perspectives on therapeutic neutralizing antibodies against the Novel Coronavirus SARS-CoV-2 A pneumonia outbreak associated with a new coronavirus of probable bat origin Rapid isolation and profiling of a diverse panel of human monoclonal antibodies targeting the SARS-CoV-2 spike protein Highlights • COVID-19 plasma IgGs can recognize SARS-2, SARS, and MERS S proteins • 3.4 Å cryo-EM structure of a neutralizing Fab-S complex showed binding to 'up' RBDs. • Structures define a recurrent VH3-53/VH3-66-derived anti-SARS-CoV-2 antibody class Analysis of plasma from recovering COVID-19 patients identifies common features of antibodies that determine protection We thank all study participants who devoted time to our research, Drs. Barry Coller and Sarah Schlesinger, and the Rockefeller University Hospital Clinical Research Support Office and nursing staff. We thank the Global Initiative on Sharing Avian Influenza Data (GISAID) and the originating and submitting laboratories for sharing the SARS-CoV-2 genome sequences; see Figure 6) .We gratefully acknowledge all labs and authors for making SARS-CoV-2 genome sequence data available for this research.