lath»ormddvti:t!m"¢’I='nto« ‘   A   
 Jar. %23.,4= ;m.<_ 1Et?CIlI!ft$- ofispzmrzng Atbv Laml; fi1¢Mffl¢tbfi jfbg\7 P[m.,.A,~.«»



‘kw-é é

9% CA .7\[Cj0 ‘R7011?   ‘D*15' C  S
:§j:DISSONAN’g §IAP\l\/1N   
°%€'Sacrcéi Pu~mA:.1quE%OA'r»HE.s, PR0T«1f.sATATIONS;3A   

LEAGuEAS , COVENANTS, INca.AegMgm~s%, 
% latcly tailfccrn many AT1;ME-SERVING SAINT-S fipgg

~ Officcrs,withoi:tfcr.up1cof Confcienccgmakinga ve»  

A ry mplefcnr Confer: in the Ea-m* of our mofi i:'aithfi1Il%  

.0azl2A~per arming, C:{‘TU€fiflfi?~k€'€PI.fig'G0d ,, andvall ‘Loyal 
A AA oonfiicnciaus ‘S¢i6j~e¢'z?.c 5 fuflicient to create a dalefall 

A  :2 1.1., and tormenting Horror in thcanmkzzezl

Cwqfiienm of aII4thc)fe ._, wheat have%takm, andviola-if 

" Ated them too, fucccflively, without any fe:.ar~c¢jAGo.~:!,t4‘ 

AMm,DWils,vr Hell.             

   
   
  
  
   
 
  

 

u%

is %

  $29

1'5
£‘-=:.
{J

‘ ‘J “ ’»-.3 ‘ ‘H
mmwnnuw-a-«-u~mmI¢|WIH'hw»uupn\ ', ;.,.-r

Cgfigy‘ WI_L£Id’A:«Mfig M Mr 3 Eflg-.54 Bcméer afLincoins..Inné. 

i‘

 Numb. go. .2. If}: mm yaw as Vow mzto th¢*?Lo7‘r1,orfwezz2*}m 
 A Oath to lzmcl 1925 Soul ‘wztba; Bo}zd,i.m_{Imll 2zorbre;zkVbi%sward,i
; %__  Jb.:=- flmllA gala. xzcwro-rd*i1z.,rzAto all Atlmt pracmzsléwtla az4tAa_~Fk.£sMz»%zrtb.  A 

'S"«%"«Gal%;  Brethren. I fl>ezzl{:qfmr tlw mrmzer ofnzm, t}aaz4_;;l2it%¢ be'%L:A:f

  A1271: .m;ms ~CoiIvmant, _y¢'t it be cw1,fim__zec1%,V%zaro mzn alijlmnnl i

  
 
  
   
     
   
  

 A fzmt f7l:m>s the 2:mId£'mej} Atzrc%dV_y¢:dup , tbeii" cmwrfr%x2rVez;iI
%  AA mzgl tlwirforce is not right. % % A A %    .
#.g.%AAu%gr.:flin dc: vmbia Am0fl:<.)'i .5?crmo%ga. Falfa hzracio eAxi%ci¢;fa%j%¢fi5ygm%%

\ jurari0%Apc:riculnTa tiff, nulla%i%urario,fc:cu-gaff.‘ATam:‘;_mg%ma15mhA¢g%%% ~
  jprurim, urqui Lapid:-.~As ccjlunc tinrman: fan!fu%m,%A;.%inr%am ipmf « Iapadm ,-_ 1+
 %%Anun;ri*mcs%Dcwg1 prwf¢r1rq_m, D¢%u m %_ y;ivc%n1§ery1‘. mum 4r ¢;mmm§_
  Ammm mmrcnmm, Drum an aancerxxprmm%v1ndmanvcm%%§%%m§% ¢W5J

 
 
   

¢;:%V~%AAIpngé eflh a ptrriwiio_?‘_]urarmVn__p1i.V ¢ _  M A _  if
-€»‘:»._; %C}njAyf,1§§gm.%x min Mm:,5__«Nxfi Aguramcntuinccrdi.g;:atur,nOnA pnAffun%r%A amputm 

 pe‘r)u:Aia,Nam0mcn:%m qpnnfraqumccr%iurat,8Uwn aliqxzandopgyjmfgg I

¢@é%   Landon, :%Prixl%1ced for Edward‘ Tbamm in the Adm a.ndEzIr: we L
”‘A"'~ A V ~  in Lit-tlaBr£=mi‘n,A%IA6r;9,.%A ; A A % ‘ ” 

4£2‘W~

$31.1‘

 %»e difl?»mnt Harmony 0 fared publi

«ind Stat11tesA ¢;)fWt:I1e Land have" formerly %&tamkex1%1;o%.thair

 ”;S‘mZsA,, Confciezglces bear; conftaxut FaitIxA,~ Alla-~
A Vgiance, obgdienge, and duE1£i11%l__1"u[k_;;;e§cS?g1o11t:cm:h\mm5 m_d to L,mb,¢d;, 
wdefgnd thcir Pm.[o11$,Crown%s,zmd Jtxfifloyal ‘P1"eI‘%Qg;1t1Ver¢, Archaiap,  '
A with their «Lima , 1;/Iembew.-. Fq1~trm¢s», A a(g;aVVx4x:1I1 all Av Edward! W
,:;«temp~t;s,% Qcmf .;.imcicS» M and~AInn%0Ya¢t1*ons%a L%W11at4%A§

om;
orgiatiomg 1L eagueI»C0?¢M"ts.E"gamats,  
H  W:  Mktm ,(9‘C'. .

 

A ”Any~are thg publick 0a.J1;I1Vs,4' P1'otcflationsg
,  sLagu¢g,QQvenants,whi«;h a}al,%Engslifh Swab-~4 A
 A jgas (efpecially Judgea, Jufiiwccs, Shae1*ifiTe',%%A
 ‘Maiors*, Mi:1i{tc1*s5LaWyc1*s, ”Gra;duates ,
 Membcrs of 1:116 Commons Hotxfe, and all
‘;pu%bl%ick Oflicers whatfoaver) by the Laws‘;

 

aflmflon, 
Trafi. 2.. (z. 
micron, 0.1 an... 

1m:.fi‘,11¢i fgmdgmy} Kings, t~bc?ir~Hei‘rs and Sugcemrsg Im bind

     
   

cmvem which fcflbris Lax, 

3 5. Spelmammg

A    flquite fo Ago*’t:tcuwbyAt‘l1ofe who have fomA1‘¢rl&y Giommmj mi

~~{%tak¢n*;= a%nd.a3%%fi~gq11e1}tly vialfptcdthclll over, amgl oycrmgn M53“ A
9111 the highef} dcg1‘ec, ;fI10I¥8¢1>].1l1‘¢L1*tl.14‘3mbY COIIVIMY fate flmivk 7 MP3 

\ *~04tbssAani1  5§;4“I"J£h»;l'!'1fiflW?$)-fg:¢£:.emt ‘3h¢m.J,«n  to G**‘”'*"..‘‘' “*5”:
AA 4tI1;eWirown~anflwothc»~sA’%icW,5 *thatA:ti1ey ma%y cc>z2f‘ciem:ic2z:11y; I*;fl**6~f« 5*
%“review,¢Q11’fid%ei*tIi%6i11¢a;fi~¢fh;,z1x1::.1;:lt:«gw“v’?«yle¢'cI1ci17}ve¥; ja.{xz~im11%s 5*” 7’ 3" 
l:"arI1eLifii;ml Vio1ati0»h$;9€tl'5¢I31p:WA1?I"€~V¢u!: »!:11w"e,4mmw>Ara1 Charm. f. us

, ~an.d Aetexvijali‘ ,;tdgn1@i;t7§:1W}3i¢11fl§3h$3W’*’if3I11%m.a1!i1i‘Yi“TI‘1W(’t Kim: et 45, 1
;;cmai;,rIyfa lj 1‘133r;113 1:11:11: ‘,

1cvc1‘¥%P¢r[o2¢ab¢V¢, W.y¢W4é1dm'1%e21%¢*V’¢1?y:iZ;3tI->immIrmw:a»s  d 34¢‘, A __  
VOb1”ig7=‘:dA  {$0 :13%k§’=. :1:?‘i"°l5-‘3¥‘*15.€. EC; ~F11$;Q¢3111'F y LW ~W iM2£hl%lTl‘YV1'1i‘flI1 mm “aim 
 11V¢A%.5\aI1£1 5{7r“:.?%S.._?~‘¥tWk‘m%L‘Z@kW1t11fif¢{h¢W’+'Y Y¢~’W«:~bJ’ 7i‘~“P«I 9:1», 191% 

jji, V " A A ‘A A % m ”

    
  
 
 
   

 ‘I"nrx:;lcs Mag 

8: A ot;z*%Nat1¢;»;w1g[I;,p¢)V fmjit:Ij.a¢, {$111,116. &:«;;«:ac€%: Ccallawsaéi

  I:4ém%ii1Wit;htf1e7 h:n:ia:nr4WtAlv 0];Fe«w1m T‘Wh i(.?§.1‘;t§;:n‘§éI3:fi

  

.;%A

~  1  [V3-W8-L

_ _ A A .A(~fi%)v » .  .    _
&Y<x‘e»:v~Sz.'zb'jréé’cs uxmdcr ffidwzzwt the Confgfl?2r, Aand;
A .9   firfi ,- %% in Jfi1b\fiancc ;aI;.1caf’c , A thmlgtx : not? in, .p1*ccife*

:

A %    ‘A;

1, . ‘ .

   I    .d§Arwm~, um¢£mm~ic11as%d;;y£ors§a}ds,I‘A’wi1I% 
A   Lh£7;,j;;%%f£§ithfu%ll%%3119” lapal to AmcAAaaa;nweamg; am:

qg»s¢e:;G1.mm_5'%45l_£3izirsA, flzzrgd wiZlwbczzAr ?I*=Fairla and zllllcgiwnca to bzm of life

C:u‘;i*;;fz.z.% *4Iézd'0f Mamb£.WC'~i3V..andA+of‘%tm*c;¢e”A bonozn'Aaga’it1£E people ~

z1.q.A5.:.ADe foi%- )::5la%i@%‘%}a%&%12«g%;z_yA_% limjtziircl ‘Jciipéi   AtA/Mt j7aall;z€ifbéé*IJ§g205%vV’no[r

mi! wfid%¢m*“‘i*’*-A 19.£‘arI ‘r‘;** off   tking  wbi”Cbrmzyii”%4fc1Awl»; %to'AjIt /stir “b-Wt “or; T Zlamm

V % ‘wage ,.~wbz'cb I _/Vmll, flat?‘ witbffztzid‘ ‘fit0«%m3w120wer. So God,
A me-hc1p.~_     % A M I j { ,  3 ' 2: A A A 
2. The fccond is t:_he*:.u,1ti'é11t ufiml Z2 0;zt£7.A of tbcAMaim4*

%fiTm'fle5 " of L‘:0 'atl;{.f:f1¢ 1Gz'Vz?tz'%€s’ "1'ovz7;‘ze: throL1ghout:-
1Eizglt{?fi4~: an,dA0f ;B#)*9l-1fioxf;‘4A9th¢¥ 011 icf Ofl%‘ers%whe1~cthea«c% M

M§agna%Chirtw,.

_Amfcntl1-m Ma%w,%%*¢W31'5‘H0"M310§9v‘%~%~%1.A.%frV\A’  AV _% _  . A,  .- % A »
jg3ru%m% %8c:»;B:z1- Yo11%A’fha1%lfWtaiI', Tfiat you {h“‘.1-fI‘I w%c;I%Ia11dloyaily{c'rVe =
31WT“m~   Afithes KING in A-;thcAOffiee ofMaio_r in%tV!1Ac City ofLo;¢do2z,..A
V A  ¢anFd;the;fah1e,Git«y flmll keep Itlrtlp farm 1'af21yAAta tba
«. ufz~nf;: om: 31-"»Dzb+tl)s~ ii%“{3?3I% ‘of %‘®i1glanb“, mm of nbfs 
A‘-‘AT9{I§(iI’;}'fi3‘.%it1g5"13f'ACEI’tglal1b;W:111d that the profit “of A”
%:% Ff che;{1«NG §r;:o11{I1a1Il‘;;i:lvan‘c;:Ai11 all t11ingsAwhi‘ch belongto A

“ ‘you to db 5% ' *'fitI“iI TTJEIIA "10£7A3”‘9 Fflffitbfi “)3 fii§bf£"of*tbB

~fimugsanb**ixbatfuwet* <u:romninV.theA raia

~:?‘A C»ity .;.VAJFz:nn«*ynn fiyall 11%. aifiznt far we Eifirztfe, t1 ot; to
sine, rnncealmrsnt hfAA figs, 11iigbtg:,11o; at me, jfganclgifi

  {B5:  fljB%%3-W37  *1 4 V’Ww?whe1jc%yo1A1  {h_f;1lI Aknow the
*5 fi.i‘ght$ * of A the?‘   or (his; 0 R.  in
A ‘ L2u1ds",”in Rents, 01‘ 1“ F1‘311f?hif6SV,A ~01“ Ain.Sutesv) to be

 “concealed or rubih:wten«, yo11'fhéll do your befi Ae11A-«A

‘%%d.w?0t11* to‘%:1"‘cgain   ‘1‘“"?f*¥?21¢?As  AM that if3'ouAV:can not%
1%‘ duet sit  {flaill toVth’e_King*, A   of his;

 F‘Co11nfi:I§“.0f 7*Whbn1‘~“‘?y%bu&,4‘a1*e ‘Lc¢rti1i11~theyf iv‘i.l"l -'it,i fo°1*n1AA the

 A‘  ?G§ *cI:e1~ec:&#.—. ~V%A11Aé1'#* ‘ that M Iawfiilljfland.-rightfillly lAyc>Af1;%

( A‘;£#ie»a1;-t§1;c~P¢ople*ofyour B%ilyWiCk,A anddo right to
AA "F axvcry cue;  %as,;w e1.Lto Str-angers as to ’P1'ivés 5  A%Awé1‘I to

F vhe*~P<>oAr  thfifffiich aAf iI14t113‘i~V?;hi¢f¥?1PP¢*?§ainéAt0~
wAAd0  ‘W?»t*i=%t*:n¢%fheArt fmy H?;230".AI‘fli0f*T01‘Baii-= 
 ‘fig-l1«eS,'&x "fem ‘ ‘1€r1fi:.5:  “*'_I10’1**fCir ’”PFOII1I.fe,'I;'IQi' for favqfrin   %

 “for-:hatrcd, y%o1.1AFna1%1nQ%t do.Wron‘g%to z11y%%one__%:%t1j1atyo1a I
A ¢ 5 [hall   rb no %%II1?1f1S%i Right , norfhall Tort takV¢fa11y thifzg
 ‘by ‘Whicl1‘*.th~e KIN Gjn1ay fi1fl?i'1‘%IQfff:f, ‘o1*'any"  “
{hall be*dif’curbcd_~5” j% Alld tha»t   i11 aH*‘1fhifl§$ WhiC hraB~‘~
*7 pe1*taifi,wtoA%thc_ Maior of1. th c% fa id.‘City fo Atodofg yqgx  
~¢~fha1lL we11*a11d!awfi1lIy” demean ‘y~OI1V1‘f€1f-j°_ %%Sc»G,o”d you v A
<:T'o”ttLés '

 “‘ whélp, »8cc.

  * %T%h%é%like caxztlas %i11’-fizbfiancé wve1‘eVtiI<e11VbyA a11Pri:2@*Cot?fi~ Magma Chm K

 fellofs Sfézté  Coz4n$tie§%a Recordqrs of‘1'0wn$ ,V“fEf-,a‘f_,5I5‘ 157‘ %

». *d,£,,,m~5’3 conf£¢bles,—~and* other '*p11blick‘4Officers of]ufiit%e“, (Jauf; gs If..r.«.
and by n-101’: Freemcnfiof Coiiporations ;, 111rc1ation'tothcdorfi 7.Kn:..

”3vi\i;1g atmbis 1BBit 5 5 a11dtheRigI1ts'oFtheCr0Wi'1; * °h3”.vf*%45-'"4%73%

d_j8  3;flat .
20 E. g,c_1',,§

“ 3.. T118! third is T1169iifb0fflI['t}.7e*_7Ildg£fS, B‘a:ror15 oftbz=

% % Excbéquer, aITd~.¢_]w1;ifiiC£S~ 0fthe~Péice5  . p1f.cfcr%71bed¢ {event}  Clauflao rE.»

  "  7,   _% A.    _ I  .%   
 Vifc flaallfwem" ,,“‘1792zt well dmllmvfully a 17341: fer*z2é*‘o;z1r St5=¥ 1;. 3 R; 3.. A

" “‘;.Vp%ars»1%,do[:. %

vcmign ibflgb the fining 5 and 1:12  P60}: 23 in“ the Oflice offz!-- VKOF P‘"I~ .
_ ffice , ml tbzzt lawfully ye j;kall%c%o1mfc?Zl‘ 1?)?! ifiing in Iai5%BI.»Vfi-« aifig;  I- 

‘J W13‘ 5 andAtbatT‘geAfi)allA‘n‘ottznunfzl‘11”o;~a[fznttoiE“?"Jim 565,4, Rb,_.; ,

WW3,%.m8*P*ifI3vfl:;‘lifm f0%%1fifi1W"3E¢ “Dz” hifbiérfflm _b12.f3“2ParI. 25 4 2 ‘g:.
~mam1e1:, “ may in; A¢Arolnt151tA :ii‘Aa,nn;A%fib"at ye f1aa11fnn*t Rubin the n; . m. C0oks( 

mmmage ng Aniff)é1:t*Enn A  *ittI)¥124t‘¢a‘Af4AV gz=*iIj"aA'E.*i not an 3WInfiit‘- 9»
13' at to” be 1nam2nVb1j> pom‘ {elf , ogby ntbextr ‘mzdtIéazt)!e;‘45' '4
flmll *db“e%z»m l}zz1v%%4;¢z,£:%\4Ea&eéuti0;z ofs*_R z'*%bt¢ra%f»g[[;§lziy¥Sz1l2j“eé?;; 4
lRic%Vb ' zmd7Foofr “nritb%o2{t»*$%VIén%*§%z;;* regatrj; fb hzizj  .fl7z‘k,jl ¢
Atlmt you takg not by yarn’ fcrlf or b_yot}3:r, wp1fiz_Ji7lié‘01f‘”c1}17eTf[‘}F§,
»  or 1-iewzzrd of Goldor Siléxef, %nor7ofa.3z}“arké1éf%tb“i7igw:jp%bicb
mzzytzwrn to ‘yox4r*12rofif‘,.% :zm_Z«_‘[]Er¢f%itfb:%%%,mc:ztw or drink, and of A
  fmflll‘ «ml of Aafzj %%3f mIm7z¥jj¢%%   bwue *—m4J%v% " Wqgdj:  '
,%bdg1gi.'-mg  l2efo1*§r% %you% , fl‘f “’_Z97'Z:g'‘' ~a&tbe fzznzeVI”1>*oc£f$flifaU5e]?9ba7¢g~§”
 _., now" After tI:2e“  izme cz1~z¢fe‘.  Aiz8i%tl9atwye:'tgigflnoffif§irIsM_
% flmg {ts VA;/?5a2‘l’ 50  AA fii*Cc*‘g,'T  Kobewf {in} «man g-;”rezz%t‘ Viar 

 

. , ‘

  %bflut’?i"’Df..litb A  ilii"r1g‘bin~1~f“nl£::—,,~ we tljat-pau%:"g7mzV{mni12 an;

~W5:é‘fig-gttnnwkn[emu‘ 3110-?m%a’n’g_rsat o3Qfmgu¢:*4“i‘it”nh tats: inbm-2‘ 6
w2:»4 amng isparw. —Amz 22¢ cafe}'fbdt“%d1gy*5. o_f~vvbur{MAAe;1%Aate

A «mm *eoml2' tMz’m they _ be , scmief<”9beforc% fizz: in ;_yo2i*r AASEJ

as - 2. % -,  .  g   , %  . A  1 “ " % % av  VI.‘  M   VA  f‘£1—»-*.’ .”
A gugagn %fb*a*~ forme?.af a Iae,ru% tflwtwv 1a*7'mraafi5mRdé¢,~aIo»*tlr§?mTéé
. - um ‘ 

 

nflqutmn “tlae Cfimmonelgzw or to~’1’m3wéfe%$the%%peo1>le ,3 that 

 may mt %pu%rfueA tine Lam ,  Atbdt y%eVdo{%%ib}%éir bo‘;:lies'* t%o7lze arrefigd %

   mz’%¢ z2rz‘m~+ "Ami ‘c[areArbmeM1, time »myL»w
 gzrrgfi. 2:-i:I£171:.,tI3aa1 f y:c.eT.tifietbeKz'z}g aftlogair nnzmeas, and of ti.§e~ir

 fi12?j}'27‘z§{io}z brzfl‘z'ly. ‘_.,  O ft IMt VAI’/aefeo %

7be my ordzzimz qomwiitafzlc

  t/2ac1§V_ye;bVy1_&yoik2*fa.AZ_f,%.:7tor by3otl3erprivily”%nofzzperru
Hly, jmxzzhtain my plea: or ”qqz1;z‘3f2*elA hazzging in the mags finurf,
j arV e~lfew}bm*e i1ztlaeACm¢2:ry.“ ,AndAtl2V;ztM%;ye deny to‘AnoT;1mzn% com-

%%.m0n"n'gbt  by tLbe.1Bit14g6   V3-iaztterfi   W none Lvotber mans»,

am. for flfan:zA at'lm' ¢;m- .: .¢ndf_ ;,.... ~¢,z_{e my «letters cm:
 ‘_yoy: %%c“o;zt2‘zz}1 ‘j ‘i5o%%1* ;a‘L$LtZxr_;, tbiztuve‘ d0‘flotb"ingAbyAfu¢b‘A
Letterg ‘bm%V c ‘er%rifieA Itbe ji3in"gA t{}m.=zof,% and gofarrlm do the
,Lczw ,.n0tWitbfidnding the: fame‘ %,%1Lettér$; _‘  tI)8fi’yB»flJalI%

%% Annwarm p:mcntz‘%t'bz"%pg9nFt nfitgw; mug smm   at tI;z d{:rn1n¢g1,
rtmtb all tbfinga infinite ye may reafiggnablz’ A?ihn%t1;¢Afame.

.44mi 23; ca~fa¢y¢§~%be frqm”‘be2zcefortI;z%fB»uml ia¢%'zlef”azz?lt~i¢¢y?z~3¢,_ywof the
.P0intsaforef.m£ , gaAfba_~I:i bz[%at we 3iiingsA7Wil1A%, of Wang,

fl-anus Aanfi 659635, Atberent to%b:aVIJm1za5, fijailplfiafz bin!»
A :z14€»Gocl you help and all Szzinfs, Anno 18  Stat»?-4.. A. .  A A

Thencxt ~:0.«.ztb is that %of;S‘upre,mac_y,111adc and prefc1*il5éd

A to be taken by all‘ judges, jy{%ices,Sl1-c1'ifl§, Maiors, Pu=:cord-
-crs,,CiviI and Ecclefiafli-calOfEcers,Barreftcrsfificnchcrsg,Gm~€~

A 1ac1uaecs¢% Millifiersgfittrt1ieS”vxf!fifl’bcVer',and al1MMémb¢rs%of
vAthc%7Comn1ons Houfe , bcfré they oughtgto fit or%¥}votwc%r
~tI1erein5 A bythc Stattites%of"1 Eliza. czz1>.»1. 5 Elizecapg it.-117

._.,C¢z%r‘.;;Czzp;. 7. A A A

    A— 3- dmrcerrycefiifieanddeclareinAmywcow‘cience,
*.That fl;2AA imam: igigbnefs A iatI;zV.n%n1:>%np;ea:n own:

  nm: of this ‘ifiealm, am: of an o‘tyer “bals iatgbnafs £Daminl: %

  am: w<IEntIt1t1‘.i&\.5, /Z5‘W611‘-iiiflZl"fS}7i'i"it'ZHZlOT Ecclefinfiicgl  

%'tbingsV0rvWf% MAmmmzalVA;:Axmdtlnat nofoWini4yPriv¢v¢,  

1% Prvlatfa St4=te:A%ori1’atewtate<19¢t?4a 9rAo#ght   tobaw ~4fl}V7“?’.ifi A
dzéflzpn ,, ; V‘PQW£?, SupeLr.iariiry:,% A rqfrelaemizmzcéw»%%or %:.fl;{€tb»o‘riz§y,%4E0n

«—€l€fiafiiCal W Spiritzyml ';9itbinV%tbis§;;sIi;¢alyg ;,":md tl5ereforc~V$I'"do4 

izttérzjr ?r%cnVazmL:e Aallfbreia j’u.rifal:ié?io7¢;_., ‘Powers,  Sugzycigriqritiesh

~4*’197¥~4:z<t1W5tie:;sArm! dopramVife4A;.t!1wAfxnm b$n«§¢f9$;f;£?%¢%3lAlIial:l    
beat  A3F,atib   ann mte§&ans.aVtaA VA.tbe,3&in§fi1Bi£bm.e;ffi;  

s:l?i5 “;f§3m%#«%VAann%  Eqmzefioaa » yann at nm% finmt

man: ggwméfin witanmt Ayr=at1?2   

A   M1!  a‘vf':é%nn 1  ‘§l5ffi3*i¢iDf?3f;f3P‘2i1?i1B§B$;y . i£321‘zr* :

bmttfn*ente5 : ant: "flt1“tbn§t*ti*w_” gtahrtb 6; bzlufimrgytn ‘thz    

  mugs igtgyners, bisilaeirs a111Jyy§ut‘c‘z?fi*u?3ys3T,yy1n3unityeb ant:  

anusma to we gmpmztai ytniyrnhm nftbisg malmyy Sabelf  

mg; Goal, dflbfby tb"€‘Ci*o7ztenTfs$of ytbis Book; .

VA  The '$13h‘_;"('Q1tI‘§ iofeyqu al Latitude and Extent, asythe

, farmer; 0‘fSupremg;cy. ?that of Mflllegizznce, p‘rcfcrib;édj%by
tihe Statutes yyo£;3y jafbbi,  4%. 7 jars.’ C. [6.“"I;7 Car. of.  ”tend+= A
A Eng yonly etc: we ecZzzr2m’o"nyyofj?uc%h yDzZty¢z:’ye$vc*ry true-Jmd we-Z-Z-é

afifled Sulajefif  mt only by «Bowl of AZlegitmce,y;V"bHtyayl fohp the

  (¥£3oi“;im'annemeu£ of {almighty was ynugyt -to yb2at.taybf5-
 9£B:a11'*e3W3 his filgeirsanmifiufcceungsgy which Ozztbfucla as are

iizfetficael Wm  %-§”l‘1yp2t?1IiI:~iflt1 do oppygn wvitybymxmy f¢;;lfe
and ;1m_ found yArguments,~.t¥be«yj1xfiy defence wlaereofi, 191?: Mzzjejiy
V. yjzmesflaaytb»l:eretaforemzdertaI(§n‘e§" 'we]‘t_bz'ly }7”é’j?‘f0Tmeal5~
to ‘ thin .grea:tyycontmtme;¢t,.ofall ‘biiyloving S'ubjeEi‘s* 2zotwitbfl;znd«‘-‘--
mg. the g“ i9¢f4zyi5dg's ofall ycyontmtiom'Ad=verfzzries;H7fdfofléeygé ybmr
greatly 6&3 iinjgaly fiiubfiects Bib appymiselytbzfatn »£DafiJ:?b€y
jzrofimtad t%/vemfelvesfyyatidsy  ‘efiz’cs~feet,y yl:‘eeeCl>z'a¢g his Majefiy
tb~zzt:' it migfitbe emzxaied , ttyattbe fame flat!) may be abmfi

 ytnwall %T*§'t1bfE1fl£. "~TI1é ywordsy ¢~wherco'f; arcs”
t»he.fe.. I A :13. dd trwlywm abfmcrzrelyry acknowledge, 121”0ff_fl3*,:.f*dfi-7y.‘
fimjy ifrazzl declafie in my Aconfcience   be_fore_ God‘ and the tvorlagfis
fzilagizzratj v<z£r%':A;;Soyveraigy1zylgoryclfxinég LEFAAS ia}Ia1nftill;Aanuy -
tyiyfibtfull . yiaiag m;a£%vth‘t3”1&na1m» am“ of »aI1yutbyéwbfa  1

  jnf€I'£%%A®nymi%nin1w-mmaynuntrtzs : .Andtimtthe%Po;>e‘,mi.;.y

t}J£1fi':Of'bin1feZ_f'3 mr by may of we C1914-‘rah o*r~Seeybf1%R0rne, or; f

y N }y mzy »o¢t£2er ymcuyytns imitb 4amg"ht1)2r,batt) yang). yp:Bw2t,iJ.3a'ut§)a-j-A 
flit?  flimsy matnivfifvnyfaynfaflvwqtfiwwiew

}‘ W‘

fl,i2£%i»ugnm1niw gi;®nmfmnx'i's; up tnant!3ngia:z»”   =*7ffizwifiyyy’r
ifigtlncz ytn””i%nhancyi»vbt. ~anrmp bitnm gis¢nuntr1u;55* oz to 33'ifv~ 
mbixrgay yang bf ylgisy $9ay’cItir‘s fiubjzrw ufftbeitVflllyegéfanscéi 
»a221nr¢£Dyyb:2n‘yi:t:yn:ca tn his i%fl«iJ2?if.’1};,‘o{l tn:gi§i:-2 ylizxzttywag rem 7

 

‘ ‘K’;

H
g

fl

  

up mannanwmtyytoyptsmmmes‘ A 

_ W V ‘VW3-*yffi~»nfierm«;=y‘y

  ’ ‘i99'i7'fo%‘nyyg ,f‘§f8’tf‘e A

V nzfiytfimherhnimnt, or ta may of -his ymajefiies 1‘ Asubjéezifs, witbin A
Majffiirs ‘;Dam'z'm‘vm.y sdlfon,  do jfnfaeavfrom«vymyyb:aft,.ytbxzry :

natwitbfiaxdiagy ?:'Zl3_1_y. ,.DEcyZawrtiow:  c'rf~‘Ex€timmu?zz'c2zti....A.

 

»m;.a1(’;» cteprizaatibrz A‘ A mgzdg er g?rd‘rt"t:d  Ttbflope ,1 ér;b;3:~::1,$:rcc:‘ “At? A 
[am by ; Agygy Azttbo1”€it_y deriverg or Ajgretengied, to; 12:, deArived'
from W, gr ms see. agatnatbe rain mug tats ilaetxzsn; hum 
A Atpflflzfi ; 03 any abra1un‘AAnnnftbztatnA ®,uAbjm:ts .fmmVA4tbzic‘?
nbznienckz    »Ia%tl14bzacA3faitb annttue 24ilIzgiancaAAta his A
. §§a,§4v§1Ps;bi9 1.13BI'Aw8nfi.9.uccefl‘ogs»amabimann tbeminill  
‘. 1apfzunVAgto tbaA*u"tt.mfmu1tAA‘nf Amppbmzc, A anainft «ailmen-

A A’%fPit8tiBA5tmnzflttemptsinbatfnsiazr: ; hibitb than be mans

  agaiAn1t_nAiAsAe; tbe‘i1:‘1Bs1:%fons,L their azmxmranu mignitp;

, by xgatmfmg colour of any racy Sggntenccngi Eeclaration;

. A 9; ottgievmifq, arm hJillAna mgrbeflfznneabnur tnnttclofz am A A

F M13; knninnAunta% his A93-ajeflty, his {§z[iF5 annfiucteiruzs,

2 ia1l;pl£tcafon§L;znnAtfaitgrcus cflinjanfpiraciea, »1nbicb 31 R331!
.‘ iiu‘em;%~fi;4bear of to bzAagaini33 him, Aanp nfA:tbABm;   Amt

, I do ’AfI¥”i‘.t1a8r:j'1;?ezzr, fl.’ ya: Blbnfrom my Ewart ahbag, netzif,
A janh Y abjure ,_ as. impinus any  V flammable Em

A xztrirw az1hA1B*a£itiozx§, 4m;a1;A gagsnm 1nb£cbbc:arcnntmu=r

4 gjtigatzh bptbzA%Pnpe.magbcmzporen ngmutfiwma by them
A Subway, fa; >mp4V own: mbatfneber; flan 3 bn1neIt‘ebe,%

 AAa11nA%fAtfti fitnnfciencz am rzfaliazn , AtI)at% nzitbertbe @apz, 

  W13aflvfiperffinivbatfoeber, bath power to abtuibe me of
A ~,x~,1)is;@atb , An;   any part” tperznf, A inbictb 31 Aacknmnleugs

:. _i11?*’4~£a£§flD   f!,l:1lAA;A .   ~  VA

 
      

lg amI‘x*t*x“1Aift;mn am A

ago  ‘nu, r2itnum:z.A%al1 '3-fiaronnsfanuwtrpentatiotts  4 A
In the contrary. Aflnn all there things 31 so platnzgama“

A fincerzlp aclsnutnlsngz am: imam: , accogning to the 21:4

A ptmlfeinogns Aby%:me~Afpn’1wnA4, 31%: am :ac:ming In tbzplain  

nun] tommnn fenfe'annunn2t1tanning oftL12%l'a1n%e"iiin2~D‘s, 
A.Ainitbput; any Azquitzncation, 0; mental ebafian, 0; (met A
"4§mWt'gtjJat%ipn%A mi;tatrnebm:.%   Elna 3] no make this A.1Kecngniti:F :
4 pm anfiifinhnnmmngemant heartily, miuimlg, aanAt:u1y, 4

..flpfln%tDeV%frt1£A3'f&ftb%jOffifflbgifiifln. 4-80 help me,God.* AA 9   A A

*__¢A gm Ema  ; A6.V To t1icfi3‘~O-1th%S AI [hall fubjoy~n%t‘he% c Protqffation, ;

fcollcaion,  takezl  in: p%jLAu°fif1a1'1%c¢7¢of I:he{'c.-Oatlas) by1aIIAthb

2731296,: 37s.%W"c11-:3 €€95¢4§1Me111be1~s, of the.%;‘.;L;aérds, and Acommnins Houfa-A

 34°’34?-93‘ 1!. A 8 lni‘-7‘:£’0zZgf1f¢IT,lit{777¢.é'9£t,zz1zj:clvoluxmzrib: takgn byall 1t%%/.942? 161:]? afiiu

% fi:’4§I;:§:a:_%¢fi¢(g Pegplez:b1§o11g1iEm4tt1a:%4R:;il7ig, andA.by all,Or_$ n10ff%0ffiCbfs A
 ,.,.;,,’3,§;gA,9:.jv=I1dASm11d1erSvfthc Army; by th€1I‘AutI}0I‘1tY-     4    A

Di“ 

% \\   Di€M"“’”iia%3M”ii> 1541- A  M  A
M ‘We the Knights, ACitAize11s,* and Burgeffes in *th'eAC‘c)m~—r «

;m*onsT Hoiifc of Pa1'li2tmeAm:, finding I:/jo"tl11e “rent g1'i¢Eof..

A *-%111orc%k$4oI+dVly 2nd?frc%que~ntI Aput in pr: étife than former-

our %hearts,%tI1at thedefigus%ofthe'PricPts‘and ¢fi%Jites,%and
other *Adherents tO_tI1‘c,See of.1{ame, have of late been A M A
“ ‘ 4‘ And have
y ~ not bar:

A , ly‘? ~tov the undermining, and angetof the ruineof the t111e%‘;“m0r¢% 1-we

reformed Proreifanc=Re1igionA Ainhis Majéf’cies‘Don1i11i$ons and ,,¢w,, ;hm
efta%blifhedA .4 And finding alfo AAtha.At there have bee11,.and have ever before 2%

V%‘\¥5x11g¢jtIf’c Acaufc to fi1Tp¢&=th"at tI'1.vC1'€'.flfiI‘I3I‘C: %6V€"T1d111’-€113    % %<
J this fitfiing in Pa1'11ame11t,*e11d'eavo1irs.to fi.1bve11tsth%e*Fu n- ft Asfime ant:
damental Laws; OfE~v2‘¢glxzrzcl%a11d”%Irelz£i2d, and toi11troAduce n0§?%_bY%d°“*

bled xlicgal % A’

%the‘Aexci*cifc of an A;'AAbitrary and Tyraxmical G%ove1'r1n1ez1t,Tam’ Afifici;

by n“1ofi~.A perxaicious‘ a11d wi%ck€d CoAunfe1,s 5 Praétifcs, Plots {C5, mg“. K. W 

a11dQo11fpiracies ‘:A”./;\11dth"at tI1:€_I_O_I1g ixlccrnxifliozgl, ;u1dH1I11~ courts of I132
happy breach of Parlxanmlts, hztth occ:afio’11A<-zfd n1a;1y 1llc'-A- fiice, Arbitm
gal ‘Taxations, wh~er'eupon Atfhe Subjefft hath been p‘1~'ofe,;%:n-v *’YJU“&°5$=% 

‘% ted —a;1d%gricvedA:v And that divcxfs Innovatiozus and S1} p%ez'~v;f“‘ c‘g::~i’”‘“'
%M%AAfl1ti%bns‘%%haAVe bcc;u~brc>‘ught:; i1<1 t~ot:L1é”(”.3£f11?1dx”AcI1A%_;*, n1u1'P1tude3 ‘*9? A 5 M

 ~MajcI~’cies %Donwii11‘iot1%s; jeaIO1‘1fiesrai.~fed%%A~ f
a”fid&J%‘fon1cntc4d%A 'betw-ixt «the Ki;t:1jg»andAAhisApeAopIe 5A aAP01:3ifl1 A

Army 1e7vyec1«in ~’Ireld§ml. ,,"§ afnd twd Armiés %bro11M§I’1t iIit”7<:¥tlic  

bawels of this Kingdom , to the I1a7.a%1~dAoEl1is Majéf’riesA% %
Royal «Perfon, M rhea? coixfilmpfionof theAi’Reven1xcs%~qfithg-Now~ qua:
(Dr“Qw1aAa11d%% T1"ma“fit‘1‘e ofth~is~*Ki11gdomA :“f'A11%d Iafilygfinding ~t'oldA and CW

V mgmeaccaure» ofjealoufie, that endealvours have‘ been, and f‘»"“"d‘ A I

are ufed to A_b:~ing the Englifll Army into a Mif-1-m1~derfi21t1d~ I f
ing of tI1iAsA Pa rIian1eA11t,thereby Ato  ,i=1:n:Iim- that A1~n1y,w1ch%f Hav; they
free to  t%OaApa%I1'ev%th?ofe  Cdunfe“1*s,:  E0‘ fig‘-‘C "2
fore tI?1ougI*xt good to joy_‘n~ our{‘eIves%in“a"D¢clax>atio11%ofi:;:M:5: g-EMA
our united Atfefiiqxxs and_B.efolm;ions,andzto~rm}ke%t€hisRaga  %
e11fi1i11g%Pro.tef£a”tiAon.  --11 A A      A";   A A A A _  A A
 IA: B« do in rm-.1>reAen¢?AofA1migb»yGa%d,pramifc,waw;¢mfi:§ ?%r¢:éfi,3io mdin-={ A 4
W V Adfifféfiflm 45% 11*“/4Wf~l1yIAmay» Wit/IAAr¢MIfl-':%APo1aver.andeflam “J65  A
true’  ant Religidn, éxprefléd iii fl)? Dvlirine ofthe A 
EflgImd,dgafnfi all Poperylnd PapbiflJ“Innov%zztion: within this R:4lrn,A;;c6i:frdj}~»  ‘

‘ Ax‘  ; ff $';;‘J“w V 
' “‘\.‘.;-é’ :/V  “"71 "“ ‘

to the firms Dofirine, and according -to thci¥W3r'y ofmy AJV1e“gg"iT??i"i1ce¥;1+:EIis‘* V
Maicfiiesfigoyal Parfona‘ Honour and Emma; alfothfc power and*AVparie%;A
VZ1¢geA°fPar1iam€nr5LThe1aWfii11 Rights andlibcrriss. efrbc snwisii
and every perfim tbht malwb this’ Frotefldtian. in wbatfl{wer%bq,fl24l1doin pm‘-1 fl
fxancajoftbeAj&me. And go my power, dndga: fir rt: law all} I may, I"will_ oppbfe_',M
aind by all goo_d ‘ways: and mans; _ejndcd*‘vaurAta briizgwtq candigné‘pjq;ifh;yyent,‘all*
[W1 45 "/W” W/Jet bjfitge. pra2'Iife,%counfi.-[5, plot:xconf}iracie£,_ at ofiberigpijbg. do. 
41!_)’IM'_f1£tItDvt‘_l7E contrary 1:: this prefimt Protqffatian Acantdnéd; And further: rim
1f’??f£€AiQA€Z1L"£5V4?4Wurdblew4ivI5~deavourrorref:werI:eVI?‘nivn and I*meA  

.  :m 5.”,

A 'E:tfi3waart?1e3t7:rréKingcfam: of gu%gA1;njg:,$gnd Ir%¢Ian%d%. ydnél nefrfia*r%

fier ’?9P¢sf¢4fs"°f””’¢’ re1§re£z"~fl2a1zrezii«qzéi{Ia my vminifea   Vorw Pm¢IWm-

7- The 4;next,;inJtdimq5 VS:b1¢2mz%L,eaguAe a‘nLd AC%bWi‘afi*,ta~  

LA l<eAnV iniv4t1m “ma”folemnimanniér .*zzf£ed.?qpf:a bem;z,A[
g and{fubrcri’bedbyMaI1Members“é£1=wz£2fi2&:2";,‘f;; zyjnglmi and
§A~Co_II<:&ion upland, by all Civih Mi1f.zary}‘OfiEéer3,V_wA% Souldiers ? and well-
 O1’dm3";C¢59 affe&ed'% perfmI= it: our I:hreé%Ki‘ng*dom:,by fin dry {pa ch] Or-
¢9;3,;;9i,::,, %"’W'W°f ?4f‘Wé?”*:r. i=:ppr°‘&%n*g;wsi:%VW">'1¥*s the ‘W? 
".I;6,4~2o,‘ to =    '-  ~  v   = ”       V  %, T 
%‘2.28.4$8}‘4" 9. 11% Solemn League and.Covenanrf‘or Réform arm
 A andfiflfifgncc of Religion , the Honour and Hap-M 
‘93‘_k3m_’:g03  %1?1n€f8 of I;heVI%{1n.g%,% and the 1?eace4and Safety of
06,807, 898, % the three K: gdomvsc of%Er2glm2d, .Scatlzmd,.,-

‘7~\3:..87.9§;39V9¢&  A ‘ » ,  andIrela.ndV.,Q  %

 :%;“r ~

A . A A E Nablemen, Bstrarus Knights, Gentlemen», C»i'ii.2;‘e72s,VBt¥r-s4

A   £5535: Minifier: aftbe Gafpel, and Gammon: of allfaru, in

A 1739 ifiiflflbfllflfiaf England, "WSctlVand,j;md Ireland,‘ 12)’ NJEAP Y0 -
zzidcnce of God living under $118 iLiing',. {and ‘being of one Re farmed

A 1’Lcligion,baving befare,azz.reye; the g1or_y*ofGé d, and the adv.»mce-
mam of tbe Kingdom ”afau%r. Lbrd and Saviour fefm Cbriff, tbe hair
mm am %bappin2£6;.nftbaaainga%waiem2»ann bisimrifzrié

A A  and the true Publiquefifibérty5V&“2$Y’afé?fy,::m~nd‘Peace oftbe iB%'iflg:-_:;
A   filflmfiywbcreirz merj one; private co2zd£t.io7zi».r included; and cal/irigf
_1W11*i71“(1€ tb€%it¢acb%€rn‘u; and blaudyplots; Canfpiracirr , z11tempI:,
  And pra£Zife:.,‘of*tbe AEn ;:m%é.e3A ofG9d -, ag;;infi%:%:;tbe%%AtrueAV rcligim 422$;

% p‘rofizfl'ar: tbereofin qllfvlacexyfptciazl/y‘%in % the tbree.kjngdom1 warm %

Afirecetbe reform:m'an.o

%Re1ig'ian,A mid bow Lmucb” tbeir rage, pm:r_.~; A "

and prefnmpt-fen are¢ofl.ate,4nd%at tbia time incrcafizd and exercffl'd3.* =

% wbc;eofQt¢be:depLorab1e_ eflzzranf tbg Cburcb and l(_ingd%om of’ Ire*]a:,nd,

Ibt-d'i§7TEfl'ed;‘€fl'd}f£=$_f‘1be{(:bI£TH1‘dHdM,Kijflgd0!1i af9Evngla*—nd.,,? d72Id ** ‘

A   we %dangerou:Ae§?a1_e of we Cbnrcb c‘m d Kingdum of*Sc‘otIand_.; ‘are:
A Wéfent afid publike ‘Tefiimmzicr; %We bdvenomat lafi, (after other
V mean; 0_fS1¢PPliCdtf972: Remamfimnce, PrAoAtej?.azti*an:Varzdfufireringg‘
far the prefewatian nfour jélvaand our %relz‘gia72% fr1mg2*utter%%i*uine%%%

_ and de§Zru6iion,dccbrdi2zg_to?tbé%£bmmcnddljIe~-prdéfice of tbcfe kirzg 4-~
dom:%in3f0r1?1%er% timeArg..%:qnd% the Eammple%afT%God:peop1é i7zotb€\r‘~

  %Natiam55 after m%am?r£% deliberazfan, refolved mid dmfermined‘ to 9m- ‘4
1er.inta%a%mutuq;l412d Solemn League and Covmazzz,’ wbercin we aflf [‘

  fitbfcribe, and eat]: arzejafmf for»biz:&felf,.wi;"b bu-nd: liftedflp  mftbe-7

VmafiJbig§fGvd,;da%fWr4a    



' I _~ A

       4   . A     A
Hat we flwllAfincerely,~rcaIIy*anacan fiwantlymorigfk
A  the rGrace% offiod, Aendcavoub in our fi:IveAr;tl‘:ApI?a9ceAs

  
 
 

 ’¢i3M7&l1iAr1‘g«I%,*th4e prcAferV€£tion of°thcAA Reformid Rc1ig'!'Ao[nAi°n
A-*:th~e Church offlcatland, in %Do&%rinc, A Worfhip, Difmilifih
“  Aanjd Government, accordingto the Ward 0.fGod, angithe
771-Ei:amp1er:ofI:hAcbePtA Ri:eforme«d7A?‘C hurchcs 5"  mam endga-

_ vauhto bcing%the.Ghurch‘eAs of God intake three«I£in~gdomA£;.
Eco AA jnzhe  nezmefl ccmjunfiiom A811 d 7un:ifc>‘rmity A in Ex€]igiGnA ,
 Aflonfcflion of Faith; Form;ofJQh~ur¢h4-G6ver$nment% , "Di- A
 reétaryfor Worfhip; and Cacejchifing; That w*cé.ndour%poA- A
A fierity aftér%%AusA,AmaAy3%a3F;per.hr¢n,%Iim in Faith :indL§2ve, and

 the«V%.Lox?d‘Amay:délight‘ to; dAwe:1i1 in the midfir, (Jfus. »

. w A II; ThacAwe%%fliaI11i~~lik 7AAn1am1er,;without%refpeét offer-

A fons,indeav4our t_he'cxtirpa%tAion ofP§opéry,“Prelacy% , A(ehjaAtz
A AA A. is; jQhur¢h~%Governme4ntV by 7A rch-Bi_{}:1%ops, .Bi{ho%p%syAA4 AI:>hei_r
‘ Ghancellors and Comm§ffaries,De2an‘s;‘Deans ahd C«‘hAapteArs,
 AnAchdeacons,_an:'i rm rmzmr Ecclcfiafiical Oflicers depending
_on*thac Hierawsphy) Swpe%ri’:ition,Hcrefie, Schifme, Profane-

A AA A  {hall be_fouAndA tobeicontrary :9 found
” .?A%2DOi&*rine,I%« ind tih*aAA pzriwer of AA%V%God1inA€fi:5w AA=-leflfwe partake; in
" oAt"h4er mans fins,~AA.anc§%th%ere§byAAbe in%A%danger*Atoreoeiv¢AOfthAeir

plagues, and that? théL01‘d may Abc onc, and his Name one; A

A iijrltAhc.thI’E¢KiI1gdbmS-  A Av    ‘V   A I _    A  
   MIA; “We  tha ‘fameA finc¢Ari%c}*A:’.;&reaf“itA3?; A?AAan:d? Acogns ,Qm¢si?" W5!‘

than this be,

__Aflan:c:y5'.imot;i’rw£Evc.ralA"Vocations, mflbnafintxt iliitb nut“-M-A not iolmmi
AAA7I¥fiiIa€8$ ann l1YJ95a»mu!;~uallyto prefervc the Rights and fPri«%- in Xe”, . 

‘ ' ' ‘ AV 7 A» A .4,‘ v “‘V ‘ I-‘at A A
M A . » AA 2 A «r Irv‘ w» A .\ u A A ,.-‘

vilcgea ofthe Parliaments, and the%LiMberti%es of tI,1.E-A3I$i‘!1§'A;é brauczch in tfm
A ‘\ nyntfiz-A3Kiu5:<;£A=wa§gieshighcfi ‘bf-‘*'::A

   

» patron am: A i1utbngit12,A in *t!jzA?pg“2feriaatin#nAaA”?11iAnJ mfntitia Aififfimz‘  A
A tbz+ttu2:~1Kc1tginu ,am1n3Lib2rAti2£~nftbéfflaingnnms ;  tjba1t ¢A A “
Atbetnozln may bear tnitmzrs mttb nurA~=mmtctenc2sAqtnut  
V’-flnyaltp, arm that haz:%‘a“bn no tbo%ugbtgV&:tntei1:tnns to
3 AAWm*“Wb1:5 :§@3I3“iAl’~‘-‘ ififififlififif AAA3W:£WHffief§. AA   ~  A  
      1v.AwemV 4 lalfo’ inn a1IA£aim£u11ne&Aendeavourthe dif-A“
A:<AAapfverie “Pall fuch asAAI}1avc been, AA qr fl1a11I:;be”%lu4den4di'”m-its _.A.
A A‘-M%aIigr£dnjtiI,% 01‘ ve%viI?=‘l%ia% fiArument_:.g°AAbyAhindering Athr Areformaé

tion0fPw1i2iOn;fni1J;init1g tbziaiug from AW   psanplz. 0;

  AAnnz,AaftbziBiugnnmsA frmn another; ntaking‘a11p5Eaatdn

'VAmApm_cA_§iv3amM§fiVfW iicaplg. ‘ tnuttar9't9AA "_tiJi"34A_   

  c ma

 MBA-®HD§2n8nt,,:;hat% :hey¢m‘a3}%beb:o&ghc Ttd 2pub1iAké%‘A&trid}3; I

s_m;1y%Vd xjeccivc coadignc-"puni[hm¢n_r_, as *the degree Ofthéir 0 f-4 4
fencés fltall require: or defisrvc, ‘Or the Supgema 3I1'l1Ji:2 affijJ 
£123 of abotb ifiingbnmsfrc{'pc€tivcIy,orA other, having fpowcrj A

W from th4em”for that cfl‘c&,Il1;all judge convenient..“    %

3 _A  And whcujcas the hajppinefis Aofa b1eflEd:Peface between *
%th_.¢_ c

Kit&1g4dom3,dcn,§ed in ,fos;nmn?ti%mes to”-Our.iPmgc11itor£, A

‘iaby thegoo_d providence of God granted unto umand Ahakth
Ab¢cz=x;1;,§=;I y %¢oza¢Iudcd5,and fiszled by both Parliaments , Vwér:

Mihg1l:_t=:ach%.‘onAc?Q£ us, aecpr_di‘ng to%0z_1yr place  in i:"t*rAe%fl,r  %
{:1-;avou:V§hacthpy%%~may remain conjoyned in Aafl firmpeace 
A and‘.%unionM1:o al1p.ofijeriv;ie*5 And than juflice may has done A

5:13; PI€,ccdenc«Artic1e£. . ;

 I.-lp<43I_'l.‘|.'h_t‘.‘ wiI1£u1Ioppofe‘rs thereof} «in. manna: cAxpArc%‘flEd in  I

V M V-'17.;Wc.fhal1;2i1{oaccording to odurfiplacés and ca1lixjgaAA
A iWn,this-com%mon caufe officligion, L‘iberty% 3andA?pc‘ace ofthng, (

‘A :LKingdoms,‘afIi(tandAd¢1f¢ud sill;thofc:AthacentcrinVtd this %

.%Igc\a%gueA andCtWanant, in thé‘ maintaining an‘d‘pLIrfuing

cI1¢r_¢o£,A and ‘liyalltiot faffev om: felines nircrt1pn;z* inm’1L'm:t~i ,M

Igfig Inbatfaefimt combination; perfinaficm, 03% two; , tn

beA.nibineh ,? anamitbngatnn from wtbmbleften untnn any A
  F0niunn§&nnA» In ,   A~9m=%~gtMa Am»ahvAAAwf‘wiau tntbeAdrnntrasAgA 
  pargogm gtflsnm: fzlbwtn a nztzfiablz inntfizrentg 012

A nentmlitg.A.inAA.tyia saute, inbirb to much concsrnnttjthz V

A  gfl»_1a;z‘g:,~.*nf%QD'obgtb2ggJB_A pf tbziisingnnms, at1b.tbe:I)“a:1nu1:AAnf
A flJé[ikin%sa b4utAfbaw11a1l tbs: was mm?1t1m,A=%§i81nufivA"831b
pnuttantlp cnntiflm tbmtztn ,« agai-um an n1:pAnfitinx! : arm A

* “ known, thatitmaybcitim

V‘ %amN§IaVr;mnim2n£:si wbatfo2bervae+and4 manAo;;ab1e"

  pzomntétba fangzgccngningtn one potv;re1:,,ag a1'Ax1fl2Aalt Emzts 

our Iglveag [to uppjje fs=%%Qr:;10V€?f¢0m@£W§34l’hfi1r,}FW§%€¢§EA if  A  as v

V Vifibitb inafballbnnaé;.it!_Atb=a:figbtof®nn.‘  

y prawn ted nor;  rtmovtd ' V  I

M A Agd‘5eg4u[¢:* tbe fia%Kingdqm%5% 4re_gmgz'vlt_y. of"mmzyzmd %;2%r.ozk¢#§-9 *
 _c4!io21: aggififl Gad,,47_zd fJi,f,SQI2 jr€_’fiI§:1ACbrifi,%  1 %%3"4;%§toAa~Ma7z%ifsj1'

A12}; ozgr ;>r;fi.¥;z2dz‘ji1,;-aflgic ~and..e?d}2gerJ,a the ;fm%z"t.;% 1(Je.re»of iwe pro
A Akzzzdflieclare befi2re%G'od%dnd tbe I:TZ'orld,. ourmzfeizzed define to ézebtrm-k

    Myer-1 f»0r%o%i+r~w.mfi22Ar. a”4Afor'1befim of ‘Me; Kiflgdomla %<e/révial/aw,
1l)atTme?bave nbta; wexougbta 22 aIuec_1 155% ineflrimable [2cnéfit%'of t‘b§__j
fGgf;:el;, %tb1a1? ‘we b2zv§.bVmg‘ laboxggad fc-1‘A gbc pur,£{y and pan??? Ilifixfifs L

A ‘the ‘Cbm$bbcJ7A'L2x%%ndlKingdome: iz2tr_m_b andjpAeace  . 91.113 ibis" €34
-‘ _m>.nant4 me‘ make‘ in the Ap29AfmteAA of almighty ,®’pjn Atbc‘
A 192arcb2t‘% nfAAAalI’bzatt5,=!:nitAb a?tArus:F Aint2VnttVonV Alto; pet7fogm1%
, ;tbg%ft1me; asAAtiwA’  flJaAIl anfiner at that great Anag, trben tb2AA
‘f2;tmvnfA4 aIlb¢8r§§A1ba1l be bi_[c1n£eIaA_M¢[t bu77ib!_ybcfe£€l3i72g
jtbe Lord %tafflrengthen u; by hi: Hal} Spirz'tAfoi':bi$: end, and to  A

C*I?u~  

 Lard? "y11a}?%%!?l“rz§‘A?%av0a’)A*4bir wrath and indignation; agzd ejlablifb

wA_%I2'lefr‘ Vouridefirerkxnlproceedingx with fucbfuctefl“, M mgay be dezm-1»
ranvce and fizfet} to 5:‘; péoplg, and enécozgragement two other C brifi
flidv Chu%rcbc.r”graaAning under» er in danger of the yakcof Am.-

cbrijlfan‘ yrauzgig to joy: in tb; frtma, or lz'}{e/1fl' aviation and Cove: *

A A ' .5

2m:.t§A 10: 155‘ 35’ T}; A yfG0d,  tbe enlargemem of 1be'%A'1{‘irigdom " 0f"7'7i.'f12!

CbfIf"iIh“a:°Ib%2$méAi%anaA£ranqui1itgnf<IEb;t£fifin*‘3Mng*i  

mm am dtnmmonivzaltbs. Subfccibcd  William ‘Lew-

’  Spcakgr, Vdne»junioVr,and  now 'fittiAng.¢ \} 1
A   Yet .not.wit‘h Pcandhjg all rAAChcf¢: ;:_g1qf’;_ fqlpmm Facred, legal’ 

’9Aithfs.th’iAs Pror¢f*=AIti.0n,.srozemn %Le«£veA audélowndmv fwcctr
A1yAaf¢c~9idingAwwith” and ratifyinmach <2Athcr=* thé remaining
Frfigmént of tho Ca1nrno2z:AHaafe, fitting underfthc‘Vpor.ver of"
th?AA¥.47:’".}’a not only violated them all itnhe Higbt*!**d€g;rre~£'v
bxthciryproce=siing~:asa§nA£tArhclaxé~t33*31Mi5Ai52ir ianri‘

‘mcceirfi;3*%c4oA:be”rmpAar*24z%;:ra;;mfweiikeyaz try;

1 V

Ti1i{‘flB'ifi,5G1l0Il1,‘ALard3Hoafi, andflfcir fcclqgied fell0W”AM»ém--

bAer,s‘, ~ burr Aalfo“ mbk upon them ‘'to‘ fi1pprerfian‘d'fct 
7 Axheié Oaths!» Aware maudandfligmaciz¢‘th‘=m »‘Af9r iv.
A ldfflfillla 9Qaff)$.3A”'5A'AA;t%O A abfohcj:%themf¢I?cAs5 ;AW3'ffi élrothers

 én¢Ai.AiOAA,feAr up an»3W§5£¢mWff"0f tht‘3r.AOwn fraf-
iA111ing,.AinA%dia?iaue‘cri&a1 V Oppdfitibh _ agai#fiAfiA a11A'anAiiAA%¢vcfy*oE

A [chcm,"im;ioZ2:d7c3nAaHAthé am: Na“ciansAw2cnari&e1£ 

‘firicy , byUche%irA2\Ten‘7 ’K‘nfhCk bE,A6} Sefitember W1 _649.difabIing

A % kill Ff£'e1nen%fifI}2I&Ndt'i-on.10 fact if: my dear: ofjjuffice wbaifacmr,

Office, beAnefiréA,

s9r~A%té:az2ivJ—4nJ ACWAI» Esv1efiafii£4i9xVW!i£«v  
T ~             %¢~gm%szz:9£iw

* *'51‘*ba';t  bum abfWen3lea‘tr‘o'I¢€rtd% ta rtceiv%é.\CbrLzfi”in our Bcarir,  ‘I35’
  Aivalkw¢f!b}af‘bim'~in.our*1iue:, wbicbfl are the caufe: of otizrrfing A
  7a7idVf1‘rarzflgrej}iqn:,»»*]?Jmuch abounding Vamoingflfl uy; And (my art);
* '~and~unf€igz¢ed pziipafeg, defire, and i)tdeamur~for our fs:lm:,”aIyuM9 A
A*otberJ ftmdcr our fatvér am! charge, wibatb in publiguh dud private; A
A*i7zAaI!dutie:%'n{e'g%veA'to7Gad~az2d~1mm,ro amend our &liaAAe:A, and exit!)
we :6 gobcfm a-nuI92'r%in tbc.Aex*4mple of am: Refarnmian, tbat %

in Aggie 1“abIc.%

U  A

I
Aw

 .~@¢ugmez;rm4eu; Atrz4i?».; deg? of ‘w}gz$z.’§’/~kéFr,£Tit(v‘ie‘c“f0fi.‘

Vfi E*‘*&‘7”"°‘  V-Z-5w¢¢’?:~§€5i"‘Aq9_f?.'»é;a(]”.f;‘.. slewniévg '%.%ALmeergsa :4tt9mge¢s   A

§f;‘°‘;*x‘;'& W2 éiicm  $3_1Iew!<iflGi@4w@?P.Ve€??@»'%?zireg I. A hbgvflwuld 

Abridgcxnem:   azml:fizbfaI‘ib€%.A~thi$AAfifigagamvnt  W11ic11A  Wholt:  

oftI1:Records  1a%iIA1g:noAttAl1¢Mi’:Icg:ilvPoWeI‘t<5;g%ads°
int11c"1‘°W= z3ai:«zié?erA;asz;gwfl4a»£Av:4tl'a;to Wifi1%éff¢s,?Aor w~;P%erfo13 vvzlutfor
P-A‘ 5 ’~ ‘ 76* A,6'V‘i8;1~_  fi.&d«I4cithe%4*wz%11thonit.snnor Pom
454-SEC Oath  ' V ‘ *  ‘
'131iecedent:*»0:zrrAbs; ~”P7’70t"fi‘~’.”-0”‘: Cmn»mr%Am114ch 16% then the
* A Z/nzwliawzmtm % CAor¢.7awatjirle*afitti%g;af€@r vhe::mgs5vWfli%g»

e1=‘?:Vt0*imP0f6*~fl“P011We~Natioll-:5A:AVW.€r«e-Ait_~c0I1f0r1ar1t;tOthe  

4       W L9rdsA,%ArW V1W.i01”7i€9d’ A0fTW C0m”?0flSf°3‘55W?.!?Wfi57?a,€W   %
Uh see. my,True; the h,.PtzrZicmz»e2gts£167-ImZAd{fl0l1Jt"io9¢ tbefflgyawhexi. diametrically

and pCt.'fC&L. .re%p11gnaA11t%“‘At%o%vaIItIi»¢f¢legal a0ath s,Aai1d to4\thcP;:tit;io11of
NarI'am'¢=A P-Right itfelgi  Cgzrvli, conxpiainitug ,_% p%r0v1din‘gf againfl

.a=‘-Aa*- ‘° 4°‘ 99-, thé“ f'uture é1dmi11iflri11g of miywatb mtmatmntable by

the §Lafm3 a1m fitatuim 3? mm 1fiaa'imA , V in precife Terms;
x-.xand% whether4tI1is Engagenmnt, “ cnonfitch, let all Law-m
%[%~:/.613»Divine?=.é1And co41i‘cien%¢ir>uS“Englflhmm I*¢—Fc>1ve.%      
‘ ,,T:A“i‘..‘-'1-m ("Z0‘AA‘A dgclmre ,  promife, 4A%Tm%"a4 mm be “ true ant: ”fa{‘t|by.
fulito age cfilammomuealfb of Clfinglana, a$iAt.i5z1em£Itaé
  13l't'IIJB1I:.{”mittjnztffiiliingnz‘=l9oufsAuAfAiLngw1 _ 2 M ‘  
V  All tbé.~»0fiZLfE1’5 ,% %SouZdic2*.s, jqfv the  ,% a114d%MAGarri‘rong
 .t;I‘1-rougll  gthe  fi;fliA:;1enAwhbAfi1bs:a
 fcribed  alid returned Ttheir%Sx.1bfi:z*‘iptions in Parchnieixt-pa
ij “Rolls tot11qir;?,A}ozzmey—mén and %Crmtz;re.s at,W'q{fmi;¢fier;who
M tI1;i1;cupqfi  thought ,!:hI1?en1fe1ve‘s‘  and « thgir ‘ Government,

tif A(btlic3_i1gh% %%:+f(3r111_ded% ‘upon A Blot/ii  reacZ2er}§,L;%erfmy? as

lafiing Aa11 d pve1*pct11aI‘, afsVifi"‘*t had" been Mfounj  1

 A Izaak», arid the fifl9A¢1‘efi_% §Pri1,~1ciples ofPi€1‘y, jrtefficcgliigbteoyfie
»~.:5??fia:~w]3adHrgmemiPV5l5¢KN¢tiqzztIl %CoI¢j3’21t:¥B?§1tftl1Ofc%. V¢1‘Y fltfi
 .E?¢é??ge%§Iif;q:§h¢I111» %V®I1.¢hffi:@‘ffi&fld9h¢%th¢irV33WtdVm  am:
; ;pppr¢‘fTed‘f  véiclijdogibledéizid TtrebI‘ed“F %’axes”%tQA

   

A _thei1iA.AbI4C>oVd%‘y wzgufé  Land A1-I1dA“S£aA.flg3iI1fi thcijk ¢

‘;':'i(?rP’té‘5“‘fii1t"’K¢il;g3and’ Brcithx~.c;7i;: "of Scbtlflfld 8c4tI1eATNeWrlands;

:.«

‘i T“°*”“° on Vt”fiAe%:6tEii;bfA?1Pril»%~-x6513+¢~fédéz"iIs@:A::m~nec1themVoutof

“flare ‘ofthe   ‘   wmr  w A r  - ’iAA»».:eu~  %   V   . ~  r p A 
  W, own, .901 saAaa1dApoW¢1aWJth fox *<'-*3. 41:91:11!gh¢flE.cont¢n1PtMer~

common- i    iwk‘obI%pervérti%%giVtwendé6Fra:rr.Ii4m¢ntaoppr«mvgtWoz2Iea

 

~weaIrh,Jv« 5»,  m‘aé.%gA‘AAGii2z~ tb‘eA W4?”fi;0f #561’? B%tfii¢é- i V5.tr%¢d vtterbi imrvfliéle im 1

Aux; A  A A:tb2zt4c%orr22p”tq%atefiszi7:ejzrdgemgnt:bftkemofijmoderdte meéztb‘
 A  A      AA         Jecomé

 Q             
‘ AA.g;,meA ftl2»;= A' ‘z'nfi1fz£mAE*1¢f~s   z%mg“AdafiVe£lwE]?‘a5i:§[Bment.  ~ ;And;. :13

%?t;hAen%  fcmingm1?rm€f0r%‘%oVer‘thueifir‘Ifizftz11t%%@ammd;¢-Jwealrb %

mm, :gggminfiA;AAtheiv%wAills54 the “Moqk;-Pwliment ?”11,;¢1¢,~% him

A ( AWh§1%¢g: a:b¢5v¢m1;.5:o uMémb er;s%‘ dulAy“elie&ed, moi’:

“ b7e7Avs “of Pa?r1ian1ent..~A

A fin byche utry We1*e~rforcibIy:  fecIfidcd)b  theif %Add5i- 
A t;i o11aI APeHtitio‘n and”Addr%e1Te%,,> the 26th. of me @647. im-

‘pofed Athisnew 03th on a¢IlVC1c)1111fello1‘S of” State, mud‘  ¢ A4

  I A.A3.da in tbeprefence 0fG0dAAlm%gmproméf¢ Wears 
i17.mt to the zmermoff of my IWET A2395‘!!! ’,1=’_.PIl~70Zd_AVZ'Z11d n2.».zz'7zt;zz';¢
the "true ‘reformed Pgotcflant Rvel1g1o11,z'7z tbepurity tbereofi,

as it 1;; .cog¢mi;zeAd Via jtffew  Scriptzires of the Oldflnd New

, efiamentA,,.,nmd mcburage Arise Prof€flm% N and Prof}_[]T9rs oftbé

fame. ‘ And that  mtltbc tmealib faAt'tyfu1itoAbisi§_%igb::

%Ane11‘a4A:tb&JiA3bhgnAA4 AiB_2ot2angA.of tba cuzommantiiealtb of <Ei‘ng-J :
W A ”lann,A Scotlann, ann~A30reIanb arm tbsmosnininus there-
unta bslongingms .-cbizfA flgbagifttatz thereof. Ami flaau-

A mtcnnnribe, Anefign ngmatrznxptamg thing againft the {Bay
 Inna; IaiUfuII*,filltblJ3ff5p Anf tb2,¥LngnA ifizntzmog  my 

ficret all-wA¢at15ers~t~l9zz5t‘/ImZl;~%b6 treated affix: Gam2jE?l, and put Aun»-+A~:'
derfecreqy" ,, and not re vmlAtb,em  %Commxmd ,y.ar cozfinr 
of A I92’: Higbn».=jjé*4, the Parliament, or we Comzfel 5 A ¢z;m£

, flmll in» all thingsAfaifbfzalbrperform t/7eVtTz..fiécommittcdtameaA4

M,,¢ C”aunfellour,m:c%ording to t/.7e‘_I2 ejl'df:31¢gy_zma{g»rflm¢di;¢r@ Am %

order to tbe good %G5ov'm1m<mt 5 plmccand wellfzzre Aofrbefe %N;z'tz2.

V  And Ajhzzil Tendeavozxr zzsmucla as-%;r'z'n me-Iycjss gmz  ~
« bar of Parliament ,_tbeAprefc%1*'wzt%ion jafA¢tbeAR‘?gbzsand Lam.
V W» tz’»esoft1:wPe0]2le.’%.  % A % ’   ” ' 

 ;T*_h?C{'f€ Oa.t:hs w

era?’fWg0 1*I1

‘V kc’ntI1ep%x#emifed 0:ztb:.~,,- Rrotrflarion, SoZcm%nLmgm% zmd.

2_g‘er:z_%rmt,{ A ml  the Engagvment toop) both toflleiri, P1’~jT,ot;e&ér
Oliver and-hls Sm jRz'cImm’5W%1th Whonl tI1¢A]rmy;~gfficers‘,

» A S,m11die1*S 4,, 4 and A fiiI.ndrY0?-‘h ¢rsi:1~Athe'1az;n;w ormofi Conn-A

A % tiéé anAdf~ QQ_1fp,orati4ons% of Eééglamd,

 

,   V A V‘ “V % VA . IreAlzzrg§§,
i1'1:2tI1eir fpécial Add1"efTes to Ricbbrdg, faithfully 
to=AliVe and _die  : yet 10 wAith?in fev§r;? M6mfhSL bift5€;”‘5wyI10t~
withfiLaxidi¢igtheFe4 0atbsAar1d flddrrfllns bY‘3}mil"a¢Il.IOlI$
Di vine provide-nce(admi1-able in aiAI 1 coz1.fid;e.race:1xi¢ns ;c-:7y7¢ag)

they Vnotonly alIVdeferted, dbut degraded hainxflsomhi-5 1{ro -A

 mémym of th¢%C§:,%irv‘.h<)%  A

?‘iWJ’°iP» With01It*<>§1e%fir9’«=» or my ofblovcf.6*i1raAordSwor«sL4
J A   “ ,    drawn‘

    V     AAL:w+ 2   _   %  ..
“ drawn  —hisqquart¢15 afgerfo Nmuchg.::Chr1fiianib1oud (1-1,.3&i¢_4%
6 roAAmanyAM%iI1ima of’TfcafuI_'cfpcnc‘, and%+imany‘§,ye‘aAr,g~¢1-g,,gg1,, i
care,byAh‘is-FAatber%.n.O1izIer5toéflablilh hisPaflerigr.[inf¢fi‘1, new;   

% ¢rc&edASupr¢m'a_cy,~ Pf0A€i'&0?T%{hiF5flDd that by him Owhjdrr

A my-Offickmfg andfnaarcif,%mofi}enclearéd Rglationg evcnffih rm?

_ mo“?m¢n‘c5 bey"o?zid:t1I‘proAbability cit; poflibiiity; in hunJAanZe:
' apprchenfion» V  A A  ‘A ‘ A A"  A " AA A
j ,0;j'icer': caIl’edin1t_hc bIdfi'Z1nparliamentm4T) Imzfia naming fince
.}the_ year I 6.48. Atiil Apnilrfz 0. ‘I 653; whA.om".A ,they..formerIy diiflr
rfolvcdgmd Au!-1 parliamentcd, fcclfudingall i;hAAeA ‘refi t3fAthe*‘foId:
 1Pa1*1f%iatn”érit~“.fittingAtill December»-6. $648 by~forccA“am§ 

, To accomplifh thisIhéngai‘uriexp&ét;:dVWc$Vx41{",~g;hAcAflrm_y£A A

A ed guard-Q, ‘With thevvhole Houfi: of Lords, ‘rw"crA¢a:ting them~%%%
aflonefor a P:grAliamAent whO"ufur‘piAng {to ‘¢thcri;{‘e%1-srcsfltjhe}

A name and power of”a¢Parliamen t,% againfl both 'LaW.., Equi~g

  ty, Reafong difmprmtedhis Son ARz'cbAardVfrcmAhi£l I?imftV:é?ér~!

_fb<ipA ‘,  un1or%dwed, %deTgradcdVAhi3 =Nm2:‘o!b%er Hoizfelof tfifufbram-I
AALord.f,-and;n¢W?dubbEdiA%K42ig}m, cafhiorcd fame ofthe A1*m  -4
flplonefla, and timber Oflicem who heIped.AtoA‘?ma£<e thAen1AAAaA%ATP%ar~%

¢1z'Aament%, &J%h%1fm a Pfotéffofg andmaygratifie the ‘.re£?Hn jhfsw 
; kinde5AC%ommiflEOned fome,Awhom 0Ii7Je‘r caflhicrfiflg turngd» A

Y1-ndfi _i0Af hit 0011    €33: CW:°: W1‘§3 TA0 01?

A pf A  thciAr; %O‘ffice%s  find pulwféd %d7bvsi?7n%~‘tho of fithait; she fTct~»up¢,¢
_wi_gh for;-e»and_bIood.  Who now thinking theml‘43I‘V'es%%AI3§4«%A A

cuxg andfi AfbVrgett ing all thAei"rf[o1jmuer, with thefe l;1tq_fodainA
AA ~1{evoVlutfia72;, GbVange;;7a8~~°thq 1' ufl rpwardg of7pAerfidi9us¢A_éreaclies A
of 0arb:—,'Protefiation:: Covcnarm“ !:p’tAhiair% lawful!1S<:)v7é*ra"iAgri3;,-~
they hav now afifcfh to make usfa Fr£e§.¥ate,nAot only dbu%b*I§ct:F
A.-our formér Tsxesin efeéf, and more-ihap tréblcd them by‘ 1

m’Ofl%A*d%r’55ittaU/ 71ewA Militia  mfln},?415mLeA%alfo :b*y 3/ New BM’, ap AA-AA V %

5"

poi!-1tcd3In”'0a1btab€4AAtaI2\§'n J tbeir Ihdgefflzéfiifetiraf tb§:APe‘;%tcf,’ A

% and other;éOfficers,AA in‘foi'§n F011 owing.   A

‘"  9 ?Tou?fbalz'fw:4r, ’ EIJ8f @011; wall  trite: fflifbfflll    

4AA"5“"“‘°““-trant tb’tb%$ <§3 9W"°m1i981U1s'mfib°"t3»fi”§Ig::3§3W“5 

1:f$§§€a'?§~+l Aifimmbtp. oz glbeufe. nbf?_Ln2ns+    
3

~ Y||'i 11°“ 4.3‘ A‘ A‘ "whiiclti H 511*-’§éil“0“¢ 

  
 

A dxamctrzcafly Acontrdr  ma th,e%AforAA -
   thezirwnmrmed JuAdge8»flJu   iceAs;.,anAéI r

 the: civil Ofliccrs GritbFfea~r;Wfll’i11Lir;1eAbcAi;1jzpQ'f;d¢.LOn t_whé7
 A A‘ A   A ,Army‘*Officers{5 Soldie1?js‘?A;_,,% andaI1Aotber§; as t.t¢_1¢iI.' f0fmél'—,A,,

L A AI2zgagememLwaz.,Vwichas,fiver: penalsics; h *  AA

_ Hivintgy

 Hamng prc£Ent§d~Y?m;4w1cb£he%fé‘ co+ntra;lMi%é’tdry'_, &%%repi1ga»%

!33Dtr%iFr¢¢9nCfi1¢3b1¢ 043538; Proteflaciona,mcovcnantsand ‘ '
Engag¢m°nt6»A1fl1a11 propafefomefew cafes of contaienca
upon%%chem%,1nth1s ag€,WhenCanfcience info much pretended, A

,3“dLi159T‘}°f .9°7¢fl7i9”C" F? m“°hP“’m’d.:.tha«t tendcrncs ofCm-

           

¢grca%teflVpretcndcrs I50 thcm.

  V5/h4ether‘aI1%%lawfii1l ram Oathé; Vowes, ¢c¢§ma%n¢s ‘ ‘ 3" W‘ &‘ 

 w A   A - .  ?V b"uA‘ 
P1‘ 0W3at10jfl8- d¢0€~»fl_0§ z.firm1y..Itnmutab1y, 1nv1o1 ab!y bina»fl_§1ti,‘,$:ml:,;0;~_
A ghq (gals, confcmnccs, ‘of all that take them 5: to an I d6folute‘,'GratiaIW1‘,Cauf.‘
~1,ndifP3“fib1€§finC¢F€o.f“5hfi-1L1 performan'cc,a!1d f%ri&A"obfer« 224"’ ‘*3’ 5°

valgéion ofthénz, to the uctepmofi qfcheirwpowerin a11veftaccs‘Gr°'i'” de ya"
and co‘ndu;1Vons,  as%1s_egy1d¢nt by» N uml:g.,,3 Q... 2, to 14, I393,’

re Belli 8: %P:i.-ef‘
cis, 1. 2.. 0- 13.}

A9439 ‘?Q,-'_G3I'3‘I5*Déu‘3'.23_-23 23~]udg.1.r-go.  bx .- A. J ' ‘ d 
PC. 1?; . 4~ PE ‘Z 2.25 P£‘6L’,"8v_.ao‘ Pfféé; : 3 .  I  f6% 3;, z%f}P:h;3Ecel::1arna;;‘]x$%&

2, 3,3i¢«ECc1€T-¢s-4-"I613 44~25- Jonah 2 9. Iray :9. 2:.

‘ >‘ ~ g ‘mum t 11:: V
 IO  VGEB. 2  o  243  Cf 24-0  IO. 37.  

  626- 2+ 3 i» «=9 47- 31» 950- 3» 6- Levic— I9: 12- folh. 2.0  am mucua: 8::
 IAU<13-.I5e .12: .1 3- Dqut; 8.19. ‘Jo_fl1.Nz”1..4;;444..w=raciraris%

4 3 «V3.7: 9,3   9. z.,, Ezr«H_r_o.5.CUpiu5 I_,mfi§,

-N¢h- .13-25-AJcry:4a 2-   5. M3f+§§. 3;. 1' Kings ‘:5 3,,

itorum T. 3.  .

  ch50“! 7-10 ‘5a,W5»7~90,n1par.ed With~HtbI‘ 6. 16;l711§5. um,-M {ides 

An 0atbf0T~€°”fiU"14T5°"??3fW7?9I1;A4I1,_£I2d0f%aE§¥rife.'wberfara Gad imer homir as
xpiflirzg ma)re* al2und¢mrb( tofbew unto:2be%beir:‘afp‘:*amifi::.tyg 1m‘,;rumGIwcos, :

u

mutability pf his cnznnmfl, cnnfirmeb it initb an mm, , tum Barbarm.‘

that by this 3Immutab12tbing5{his 03:11 and Ccsvenanoin 3E?$;?:l::5 ;‘

% which §tt5‘mP°1Itb.[3.§°3 ‘E93 Wfifiawe "7751,-57%! brweflrong c7or2fo- éftca‘ quam
A . laxiyflg 353,4, IAbfl?.5  £?1awq!ea%flWI1flnt$witb»my%c};%gfi:;;,“% japcrjurarm A .
  have finngnuma David my Servant. ‘flap “dlinimnaut 1ni1l4'g;Pa&¢ Tponfcfi

110$ 1322813. 110? 338$ £118 thing that is: Eons nut nfznpltpps.§§3S%§’;Ztnyf;

07106 have I 11003" 5.17”) balififif-‘V that 3 mm not Its; unto E>aawA%g,11;c,,’§mg_A -

A ; 2-.-11.“Tbehgrd/Mtbfiuogznintrutbanti: ®abin,I3gn.nziqu. Rom;
    1Ut11.fl9§;tm=u tram It he 33- 20,21, Arm fmme Lord N"”'~’""-'* Vin“ i

_yo%u4can4 breakm} <1En‘bm13U3ofibc]d¢},wand my dfiofienfant  

In %  fb5T9fl”\u[’d.,U0l’ ‘Q€  flight   72;  %  _%
 T/aer2'&* may czlfis my ¢ofi211a.tit bz4VAb3oB%en1%initb manggfimyresmrorrtnrg 

¢S_grz}4nf,% tbdt befbauldzzotwbazze )4 @5322 to reign up"a12 bid‘ tbronjra lfrflmcnto ar&i*§

Gbds %0atb: aqd Covenant: to morMtaIfinfu1mcn bi: thus truc,A‘?§:Er°CY°1:}¢*E
‘  * V ‘ ‘ % % -M  . Ice-o §

  €072fl’W§*%%fiflcere, me, ¥m;4lte f451e,imm‘uiabls;’thc1i bylike Offic I I 

  reafon % 4

omncs u1t-i- 

4 A V  :  (F16 _
Emiafwdn %Vflmu1<f%nwn:~ -A0z¢itbIA and

C ofvcnanta~ coevoa+ama~ ¢Am:.¢4

A I«;v2fuI1King;befuob, as A Pfa1-%I.5- 4. «Eeclefl A8. -2-,  Gal.3=,.~_ 1A5};

Lcvit. go, 1.120 I 4.. and AchA¢other%,%forgcitgzd Tcxmrelbliic.

A 21-y.Wlxcch%er; thelate zziodlaiian¢throughAfearg,or _fi:lf-refp~c&s,,
 much more the wilful! I'ufl’ffi£lltfM.,perjt¢riauat{r:pgal,4abrogation,
4 Aqlzjuntion ofour ‘ facred1awfi.1l«OaI:hs,« L>r0te:i‘§tAatio»n, Ccmenanr,

ks‘ AA“?-’fiiA"’ be, not a km/2 deteflabIe,cr_yz'ng,fL'andnlam,damningfin,emeeding-

Gfijntiana 13‘

16,0”-lusj, 1151, l_y;dif!J»wzarable:«wA Gaél;ii21juriam;;ta Rcligioxn; efidxawing dmnf¢d.%

 @§jlJ' . Czeliusprivate,perfimalxmdNa1ia%naljudgement:,ontbofiwba are notori;-»

 

hogkgixgusf   aufi} guilty tbcreaf, as is mofiMappAarentby“Ez’ech. 16159; c.;17.

 

{ jI_5fl A Brow. 24,. 21.122. Jar. 5.%2;c.17._ 9A.%to“17%. c._g4. 8. to 22. ca

1 mo my. Zcch. A8.?17.«.- c. y.3_,4A.Hmfi;1e.;4; I;é“v.%6.3 ,4.Ac;19.%12..‘f
52. 3,4. ‘Dent. 3 1.20. c. 29. 20. to ‘2a9.P£278. 10. 37.5 75»

to 65. zChron.3%6;.13.]ofh. 9;. 20. 2 Sam. M. 1. to 11.
«Jan. 2.3.10. Rom. i. 3..1,32%. 1Tim. 1:.~Io.worthyfad and jfi:.W
rioua perufal. A AndAwhetWher thofe who are deeply guilty:

ofthefe fins, can ever%ex1pe&*to~enter into heavrcn,ifinc¢this

isamade the {pedal char-a&er of a Citizen of Zion; Wbbfbafi

Admzfl in-Gad: baly%~«bilI,,WFfal.~ %15. 1, 2, 4. He that m1I§etb&up-
rightly and worlwb rigbteaufnefs , and fpeakgtb the Vtmtb fiwam Alba,

mart, 1%-tbat,flueat2tb »mbts.~%4n1nni£3;urt uni! . 7%   nn@,%4A.%
%%mu+ch A’momNe; th¢n% Whén F01‘  AA*.‘heIpubliCk Agodd; A
31y. Wfnther thofc who havcmadc, taken”, and equally»

>5 violated allmor moi’: ofruhcfe com:nadi&AoryA Qatbu, prmjmi.

  

fainh, confcicncc, honefly, religion, ifthe sprcmif:dAScrip-

A  :=%Cnmn;am:, Ing gemm_t.r_alike1, Benet perjflre pqrflmr, and
V Govenant-breakers in folio, void.’~Aofa1lA+Area1%fear?®f   d,t~ru%eh; %

auras, or EccIe{}9.2;;A&s—~'5:3-,4,'3o.. may be credited 2 %Ai‘nd«
%*wh¢th;er thofe who Vhavc;~A%been%thus pcrfidious, Aperjurious ,.
fidcfi agus, %%treac11emusto_all others, can in pt>int5}Wii’i *

; %mnfciance, %prude‘ncc, pelicy, impofé an»%0rat*bA,t1pon-all on
V  any *o;the%rs,_ to be trumfaizbfull and canf iant,in their %0a‘tbv:,Cweé
V Arzanu, .trufis:»an.d;obcdience unto lb_eAzn?'\( ?‘.fP%eéialIy before fihézfii
“ fclvcl have takgn any, fuch Oath, to bc twzue, faitbfull, eonflazzz

to Athcir‘ own principlxex, or AanyA.fixedfl:tled Gw[érnm%enI:) hate: A
~Va:bay,have   lzaught th  be Atrcacberam,.1rerfidibut, diflo_y{al,~ by:

.~ chair Aowii pmcidcm: examples 5 and: God himiclf ~h,athfAAAde'-»

A 'moAuAn§¢.d this‘Wa{,~ and xma1Viati:o»nagainfl Wéfuch, lfiy7 33».
  H/0.P«'?7’”b¢’3Ibatdflalcfl-t1¢¢cb£roflfI3'o“ and tbe_y@e4ltm1=%mwebe~A
  V    row:

W'fiufly"WiiB ltbee ; wben tbaufbélt/mikgl4nl‘c2id"!aWc}:i“f%'e‘aEI§£’?5:?&7J§lA
 tbejflialldeall macberoujly with tbee. _ Which wcllfilhavc {Em va. 
. rifigd .95 Law in“ ;fundr<y.p'arcicul;rs even no idmiration. 
«A-divine retal’iation,V’ to dctcrrl all henceforth from the danggg.
7-A-‘roux Afin ofPefjAury,l Tr6d€b¢fJ, Oath  Caaenam breaking.  ll

A~llcralble§ ifnoc:Acheifiic:I prafiice, for anylplerfans whamfhe..w&_l ‘ A

% l . . l - , ._ . A % _ qumompc
"'iVC!"(fC{P€ClIlly‘ without may colour GfParl1amencary.l.Au~"liturwu*tri‘q—ul
AA-Athorityl  limpofp anyoath, Vow, orlilllcgal Ingage-Amfmc funt _p§’rimfi AW
 Hpénllothers ,1“ dxamemcallyl repugnant »co,Ainlc%<)nflftcnt with hflmlcldw 
«their ‘former legal 0aAt’hss%A Protcflations,Covenanm,Aimjpg...

 to“ lmhcir’ ,lawfull*Soveraigns. to Aenfnare, wound theirlC0m pomiwmw 

fpparcmfi 1?eriur_ye,=—Aland breacwh oflall their former 'é0atb:,
..«%Fra:eflqtion:,Govmanu? A And Awhavher lfuchljncur noc,thatGmml«l:c,

 . ‘I 7. }Whechcr it bclnommofm I‘   .  ’   ; ..;”Q13;’3 P€'5“"i
 4 y 4‘ . , 1 p ous, unchrxtllalmexe re c?!IWu_i¢

    
  
   
 
  
  

Domilnyscfi
fed on Ithfllfl by unqucfilonablc‘Parhamencary Avutho:i£;y$:i;;: pl-11:5‘

fiievnccsl , arid ‘inlimlvetlncm in the gi1iItoAfunlcvirableA,  "1“*"¥‘ "5  

0

95'
8
E
3
Q.
3
""1

am dilexitsifli’

” W0 in Ifzj 10,112, 3. ~ ‘f’ W0 ungzcav than ~that,dccrec ulnlrlighs M. my 5%; A

l‘! teou sl d¢ecrcex,andAthat ‘writ: grievo%ufn¢H°c,which cheyfhav¢%AlAugufiin‘$% %

‘”."pI*e('cribcdA, to ‘turn iifitk thcl:-1ecdyf'x'om lzlxdgcmeflnc, to 3f"'"'“'"3°l '1'

lffllcakb laww; the»! right [ from thcllpoor, ( cxiledliojal Ifl;,¢A_);l.

vgrbifi 
 and chauhtry maf7-;1ObAt%hl¢ Father1¢[$,-,Andwhacwlllye do L =  

ll “ in the day olviiication, andin ltheA%de{olation which flaalll V‘
7! “Acounul fromfa-r? can whom will ya fine for_help‘,A é.n‘d 
j '?_jwherel will ye 1ealvcALy’ourlg1oryll%A? 4  .Abl4b;A and, jejhbléix A
A  \'  agdilnfilNaboatb to gai,n_hAi.u
W/'A.?inlc_§w:ir4:!,A who attefleda that Nabmb did blafiahlcme Glee!“ l
"“. ma the K.‘ing:* bfoulght filch a heavy doomlupon chgig
l"“p¢rl7W8 “Pd rflxfil .P01i=rityato llthsir A utter Cxtifplltibnr.
A 30  fwmiudgcmanasillflmlllrch
A tum; wfio Ihalllendeavorlto makegomi Whole3;lKi*ng§{on33A~

px:r§m~cd in the highefi dégrlcc, _byingagi'ng Athem%l*tn.regAmm%l

Blafpbeme bo.God ml 1!): KingA,8z abjnre chci.pfolrnp¢r‘Q‘aa:hs,
A j Glmvmlanlts. Pr0t¢f1:ati0ns,l4of purpofe toglflmhcfic thnlxjoyail

lPum-xwicyloil ¢heilrlACrowns and  which they um  

A 1'0 pvmcifl-:ly fisvonin, protcfied, covemméd lover and ovcr,%i;;.l.

A Yiblably mdcfcnd and prefervg?   ; A AA

 51Y~l=WhW!3er i.;Acanbc jufi. cquitablcg {pr1zdcntia!,"iatiq-
ml, for =_anyi1r}prcfenu«powcr,»tolGommuicml "intrufl;im» 4
P303?»-dflwkflfiwa %¢13$TW;    0:13“ ‘Milmv 1‘ 0y3f;sqrt;;*§é¢¥* X

a‘ierr\byLandan:=l Sea‘, %wit!:outVpref'cr1b1ng any MiIitar,y ~

'“"02ztb u%ntt>tb em@, (’ after fiymany mutinics , and ?%viOIations%A*of 5

their truflsyto the late ‘Kin’g,%Parliazi1er_1t,;iand other new“

WG0V€1‘I10U1’SaMGoircrnments of't:heir o”_WflfilVfire&iVng, tvotheir
A total Afubvcrfion ) Vto elmtruc, fair}:-full,é abedient, and conflamtia

ifice vég‘cti-
? s dc R '
sari, I; 2. %
Slcxander ab
[exam-d&r=£_>.

sf:

r

      
  

 - Cafvini % W
kcxicon ]§1_;fi-
 : ‘fit?
ggauramenrum
gmxigare, Fr,

jhnnanus 75 ‘j 1.

 C‘. 3. Gm ti;
ifxs dc-]1;u‘e 

*“§».~r1i«,-V1

% ment,wit;hin_the Statutcof M;

e M}...

' them; V’ contrary to ch‘e.»%D%ifcipZine% bf all for231er— Age; amongfi tbe‘

Remarm, AGMr4ecz‘cz‘n:, as-zd mofl arberiNatim:,‘ who a1waies—*im4
pofeddbfi{i!ar_y0atb-mz «Ii t%beijt%V1Arm} Offitery, SouIdiers,4(War+;-
l'3I1'-?CdV bYY’Z,*TI‘m; 2*, 3,4.. )A~nd inxth-e meafn% time to inforcé“
fucha 0:4-Atbupon all thcirjjwdges, }'uffice:,andCai§i‘iI%4(%){'E=-A
cars, againfi thAe irV]udgcments, Confcicnces, ’ whofare arm
doxinifleligiozz, %zippro ve  ofj~%lawf'uH%  @atbr'1‘s( impafed by legal j
Afitborityof Parliament) Magi§71trzc_y,  “arfzd %Mim‘flry, which .45»
nabaptiffs, Quakerx, and mzhexf Seéfizrie: pr0‘fefl~cdJy.0ppugn,
and now vVioIenLIy« endeavour Ttofupprefli: ;? ] And%whcthen
Ehofenow fitting, or any other; who have takén%,5%cEr ¢%foVre’¢:i2§~%%
ted V0atb:"tovthe.‘?late Kixag an?dahis_ Héirs  »or;theVPr‘mflatian44,  
League,+mI%AAcavenant,% ~cat1 without apparent perjury;>;anddire& "

A V‘  violations of them,,rcpute thofe fctiz R‘eliqucs%of the 016 AA
' "’°:?sPa%r]%iamenr,%nowwiittingf forcibly fecluding the Lords and

.%Majority% of thciir" %‘Fe1Iow.Members )‘to be 2 lawfull Parlia-

      ‘-   447   c-7?<5I' Tubm4it«'M»t0§ya?nyA
athe,~Taxes,'-j EdiAI  %%f’3‘tili€“ir3*““?:is:*1’i3.rIifimentarice‘ or Iegalih ** 

 

n ‘  6. Whecherthew forecited Oaths offirpremdcy ,. Allegi-

gizmce, Maiarrg Sberiflfr‘, fiudgéx, Kecord¢r:,_¢Baylifi'r, Parlia-

; ment%~Membqr:5 and others, ~in  —dire& wondis:%ext:end%ing4%no15
A only to the late Kings perfongbutbigfiififtfi annéndceifazsg

do not ~inviolabI“y bind both chem,.&tl1eir Pofieritics ant!“

%% jpurAwholethree~Nations,Kingdoms in p'erpet%uitys1in point: A
Ii‘

raf Law and rGonfc‘icncc,‘ fo long %as~%thereis%—,% any; Heir aft-hc%
brown” and Royal line in being ? :1nd% xh3tnpont—hefc$una11 --
A {Womble Scriptural préfidtnts and Iegalttqn fidc1.*atfions.. ” »A

3*  ..B%t:,caufe Gods /Oath %aAndrCoven;int V ineide torfizzey Aéré-'4'

 Imam,“ Néivlfg*—;tb«eir; SeedT and Pa]¥erVi1_y5‘an%d‘to:the 1fi*aeIite::‘zmd%%

fibeir children; Aandftbefir Covendm made to*God,'by Goduwzz refaiun:

A jiciqjri, dfzf qblige Gui bizfifilf and them in perf2emi:_y “Gmeratim %

739 Ge;z¢r4tz'rm_.,$ Gen. 3%; 153-  8.2 I._;[ 92,; 09. 1:", to  750.1 3 ;. 1 6,_c.; 
"II %'$+A 3f8’-  9?  ,17‘ 92.359 23' 3‘ ?“ I 3* C‘! 34"! M74; *7"; 33* ,4! ‘34‘v.1~4-” A
 EX°d+29~43s¢- 3+ 7» LfeV¥t732' 3» 4~ Nllmba 

 , 4AA (W91, W , W
;*39.."  I2, 13?. D¢11t'._IA.‘3;.Ac, %4..3«!"3y.   é, g%j;~¢,17;V%%9,  %
'1 13. _¢:.. 8.; 18. ‘C; 711. 9;. C... 23. >46.  19,'iI3 45%‘t0,2.0;%C;. 30»:   %
%  311. 21:-ci% .34.. 4. +]ofh%.7 .:1 I,f1s*5. c. 24. 3, go 29. (3hr;Qn,~
A go, 7,, 8. Nehg  5.%c%. 9.8, 32;. Pf. 2f5.”I3; Ifay 34. 5.‘ c.+44;% 3.; ,
:c+59; 21. c. 6-148, 9- 1:62. 22.Mal. 2.45:0 15. c; 4..H6o'._A&_S 2.;; 

V ;.c. 3.25. c.7.&-3 45.. c.% 13;. 23, Rom. 4. 13 ;1_6. Ic.9;;7= 8..
3911.1, 2,V27.%G'a‘lt3%. 16.t:o thecn‘d. Heb. 8-éé, to ‘II; c.a1I..

  18,c.w1;. 2o.Lu‘.,72,~4473;.d% Rev. :1z._I7.eLevit. 26.«9,.,1&5V¢.%. 4
V % 25, «+2.» 44«%@Kwi"gsM I7-:15: t0+!+:1.- Pfal. 44-.4417, r8;Pf- 78"xI‘;.°.‘.~' A
  38- Pf- 39- 31:45 59-34» 35- P9103: 7172* 134-95 I<—T"5'~.r 3s?1*°~VPF   A

411% 1. 5, 9. Ifay 24. 5.%c,4_2. 6. c. 49., 8. c. 54.13,]er+. 1;. 2,150

1’I233.22g9.C%.3%%I,3,I,32,33.C;29.1C),t0 2o.c.33. 20, 214:. _5Q.:3.% 
Ezcch. 16. 60 62.6.3748, 29.c§44._..4..Ho£ 8,. 1.1-Ieb.6A. 16,17, A Q.
J .wThercfgg;:h%me11s M Oaths, Cove11a11tsmto KingsVa11c£%th¢irAPc)-y
'fic14i;y:;% miiI{IAik¢wifeLbi11diti fi.1cce:iTiona_nd pe;+p¢tt;w_i)ty.,4,   ~  

% A  21y-" B¢0auf‘,é Guids I Oath *and%%ACAovcMi1anu=%madeta:D4;¢Jds ’ R %

dud (0 his 94:": Rqyal Feed #7221 Paflerity,,.toucbiI1g their ]'u»c:cef.rio§z
in the: Ii’a_yal<T/Jrane of Iud;zb,was hereditary,.fucccffive, . ‘cxtAcn%de-

_ ing {Z0311 his Iffue and Poflcricymnd though ~mar.1y ofthem 2

% were Wicked, rebe1Ii%5)uI,  yet this did not Acaufe  jor provgifie
(~;3‘od~ 1:9‘ dc thronc,.: or difimheric,._thc%m  carAinftingc hi; Qwgtlr

[land covenam: to David, 2 Sam- 3. 1,2 «to thcfa«c:nd..Ac. 272A. '57:.
i Kings%%z..'3,3.I?[al. 89. L2, 3, 33,, to 3,8. .Pf..r 3,2; I‘ :,_;,.1«2,13.

PI.) 1183 ‘5”o.‘7J¢r; A g%3.M1%7,% A 1.9, :30, 2 1.;1C«hron.%28%.%AA,4g4A§o: 1o.A A
 Jet; :73‘ 2.51,, 24,‘2,5,26. 1‘Kinga I 1. 12, I 3,.3‘§,3 9, =2 Kings‘
% 9.  Chron. .21. gay 5, 7. 2 Chron. 23. 3, am. VJCI‘-:‘23g 

5. wZc{zAhh.%9. 9. John 13.13, I5.Lu-1.32, 33, Therefore

A%much4mm'e whcre%0%a;chs.; 0ovc4nam=s%are madcby S?ubie&aito

 thflr:W«éi‘bditérjr%%¥?I$Tif1¢gs‘izillcHéir%Pafl¢riwty,uhéyeayxw AA

inViOIa4bIe@, and not be abrogated bythfcir tran%fgreffi0n%s“f’V 

 %% fly. MB-::cauf'c t.bef04tb4, which Jofephq took afbii Brethren,‘ 

‘% gbiidren of%Ifme1,= to %carry%up bx? Bqnc:,.qm%af:EgyptinIo OVanag1f3g A

% wb%Gad!¥éauId bring-tbemVvut of Egypt,Gerz.5o,4Az¢,2sA:th¢¢uzh

fiat midi ?Pf¢€3;(blg£g;%th%em and. ghcir Poflcrity5 waarcpuced

  V atid rim;-m§€c3 be obligatbriétbtheir iEcd;~as«if~ma ck

Y   9 by%'§hcm_,7even in poin%cflo%fCmS%onfcience:*a8 is.c_§id%entby%’%”E¢3cjod:
J‘3;..1‘% 9.4m! Msfe:”ta ak,tbe Bane) afIofi'pb with Iaim,(t;hough drivcxg A
" Out of%VEgjp;t§1%%b‘yvPbaroabin%hafl:)ffIJg[b£;:bflh filtaiflp fmngn-we

f¢%3’~“°?¥*15r#f31Tt8£l:faying . G04aWi*1fWl7 W! W» and???’  

s’fimll¢a:‘r_yw fmba:m;:£ez;c:% ynu...A2 rwhich bones .ofh%is”'thij7 ¢

  vegmei 0&fl,1;:) ,.nEaEW.iEhfl1l2diflg‘ Pbmoab;;%~%%w,,;.
fair am-‘r  ~AAcanrMa%angmmhA» ‘Avhem3~wth;raughAA mum

Sea;  *Ach.rougla%t:ha wfldé§=Hefl¢‘f0rty4%Ay¢ans. and dwaugn '.

A: ‘the :;:Lant! ~¢fWAE4mm',-;Vti§l  7¥1ad*iquifae eonq,uércd»icg 
  withflmdimig  thyiwwari;Ivjb:f‘24¢ flu  sAoAye;¢r;Aafccis
; :hisa;0wh%;fii~§¥mndimaben mfixgraym, %aM'aq1l;:he Ifrwelixer
  

 

 .;hé§ii€“d«'é§%i?‘1§d%"?AA:A~:ide&orA§  fdut3’§,u'xidr*cd*§efi~rs»E:A§‘ar>;:;

A to carry; up Yfifipbk dead borfies ‘on’:   in c§i:witAhfi4andeV~<

AAAce;:xrcim£:ioa;fty:"hb1agedAgBy~Itm

iflg.-‘7?all~ ¥¥O4b§¢&ion£ ' '61?’ %haItA’~anc?ii% danger firém ‘Plmradb 115116 it A

V  thjeii‘  :y’§:ars:w7afidrh§g irfmfie wiifidcgfhefllégfyhcir
 W3.!'8*‘C Cdzfizaéz ; %tnd'%A'**mm5m‘ITé of &tl¥::e matter Ain*rc1;iy,tiun to

A  e:t*he-it»-%pgbEiéI§ {a§E%ty3nm%1w4yes Acot1c¢raéd‘i1fit;%  f

V , ~ 99 magnar

-mm‘:  %An%eei1o4rs; find émr own partiaular rtiterakféd
 Oaths in preciféyzerms tgczs og1rKin:§zs; ifhrsir Heimnd S_w;‘cc£7B,
%f‘<3rs;W»hich fo mucti ¢an«c.mx  pubIi¢kA(i0wrnm#*nt,7E*¢me,
- S‘«ettLIemt:nt, Séifé;ty5' Pm I'pci*’i@y ; em~V%.A<ag,€* tixlsifif Whv:3"Ia:~* VKix;gd:0m
,argd,chVrce N moms to ha can f1:2i%.a.s1é1:.’:i¢Jz1"s ob£"crvaAtfdir of ti‘1§fr;1:i4 sq
 thcfx;i«exie1§rrxoi%~-o.f'th.‘¢?ir pmwmr. A A A A

Ar  ‘A‘B%ecaufi::’%Duwid.r «%_Vt»;m1_:o»mmz%md faziratban cxtmdcd
  m   

   Vt%»;aa& t§rA£mti ;;am:1:%:§”:ou cm:  men,   meg
~ “%mt‘-wind that ¢:?E1:<.;»x.i wilt n~m:d¢flrcay my ma%n*m  ui'%’myy~ Fa-;
~“Tthcra«Hou’!'e :  wwmevtmto %.§§au*i‘: A I A  to; :14,

 *%~‘té 183.: 42%.»   né A ‘rT0mwt@fia1rg»tt5A‘ .13)d;w»id,t uou~§(I1ait;%% mt Only

A        I

A ‘-‘~4d’ive~VAn6t,   %tI)m¢i w«a1%'VAnaf ‘¢:‘ut'.~:iff   %¢%

A fiifrnm 111194 i£9MféAf¢g m:t_.,m tam A j{J"fi§1 I3flhArz;: limfi f1:ii‘HVéAiit¢1”3Wf%i' 4

*“~:he«Eu¢m3m 7a:bi¢”V13‘flzfii7civ£3%3*1s4#   fag: 0?? t‘hcE aMI.}

V A »:¢‘so “7-nmmmaasm      A  F  

L A *9‘ DR Viva; ~4%..%:3fl3 ;%mgiEdm¢au!?:d %Z)awid tn '%1'§I!%‘r%‘-“3"’»‘- 313§8i‘%~‘*i  

A %: 6*:V4f.¢au& ha‘ imam h‘ijx”n.;[  nd Ivzsreaewn mg In z;:ram, gm in

  

“A fifty»? ;;€:3p* wm:1ch%a7:%%V*4w  Atmogn baytbnf ustbf:

“ %  AA   %r%h~.=;§ "Y.n%*AAi%A%1=—g7;‘ik;i:)j%a~r in. miifié‘ Mid

 

A‘*me.«ana«b2t1v”éw thy MeMuI1_ mm: rd; abet.   Haw ~
jbflciengibmfly Ij}d%'b°i4a’ iibfcrxmd i:_l‘1't{‘¢ Umths am mm: death: A
V eff &&?u*Ma1dr¥Ia:2atI:“sin;A%is“$4$a&p§»amnt%, mm: oniy byhi!A1??’?.f41Inr,
; ;_d«‘7Ic:lyafi&1"9*7!I A to“ A¢'fllb17bil:a%IV*7m“Ii~«%~’far %jouaul»1an%sf4}_e5 ‘xvliom b¢%A~re#%

A {Med

we  

ifli?edtéaL"t1!¢!A~VI4:§aulv,¢9' made b:meaieon:.a=n»éaz),yA My itmg;

    %asam.9:t~&c~Aan36119*fl4Jing%¢fABa=mh 4nAdRwhébAAfor mm
  AdeAring Hhboflnqch. Sauls Afrm.-. birflomperim ,~ when they brougm
' ,bz‘;s Ahead unto. bimgexpcéfifig avg-Areamward, Ag: Sam. A4.AABut mom

*¢fpc~ci:aIly by bicfparing M¢phibofl1e~tAh,%1bt Son of;mat:han,1beVV-*A

 A ~fmfSaul_A.,A; hmufenl tbs3Lo;b#*AA£DBfbd£b§tAma£ betmmzm
M '  between Da;v~idA zmdjonathan, Cextaendingco tA:heiArAfc]edA4A

Aand pofl%eritie) wbesn tbla Gibconiitesgdc

A   A AA A 4fiAd‘d~7-Pf I1"-'Af+°fi!*f%
Snul”toAIe11elive.red%up.7toAtbem, 3ASam. I‘I.AiA'5,=-6a%AA7; ‘   A

J M 23- 

A 7Iaokupan1b7¢m and um tb2ix:AA~febn;. ant tjipou a1I..ru:b- asA1upm=.
A ‘ mtbzmfeliacs unto mm, to as it {bn.u1n'nn£ fail, A tbat they .
A £vgul;1_A1¢;g.epAAAtb:2j?:A t,wa_daye.:} vf Purim, Axccording1oAtbeir%uzritingg,Aa‘n*d5A A

££E6rdingAMto.Atbeir apppi12te%dA%tima~ez/er_yA_y%:4rA( «Was thofc. in the A PVar;~ A
liatncnuof 3  1]. and t;h~cirA APo+f’:eAriti¢% bAd1}A6=0_b/.€f'£l£d: tbs 
5 of Nommber 472n_mlly  everflncea‘) and tbatAtbofl:V dége-1Afbauld be :4‘

  rsmzmbgen am: kept tbgongbout 2iaerg<IBbi1erAattnu,ebeA:tp ;=

A  A';;E;nntIp,.2bsrp. apzufitutemnn wary <II3itpAAA;;A%AandA :bzAztA tbof: '
' daye: of Afurim fbA;mld;not; fail from among the Iewu no3jfbe‘-  7

A A A mom! of tbem'p2tifl)V‘Vfvnm*tb2frtfinA:.mbicb they D2c:22n%:.=A:,AA

  fo~3.tt:smre111es ann fog their f¢1E:AD;:*;Ift:he”whcfle*%;Natiomof 

A thejewca by an AOrdinance and Duccree, m;ight*:chua bindc‘ ‘ AA

their feeds, %po&eri;£y;y;A.jtoA A:t:!IAef%~»daAiAzAer0,fALI’1¢rAA A s>;ifiar;;A4merA:A A A

 1ig¢;Ar¢a{on$ Ath  m;i_gh&tb¢ ;atj0atfb 8cGoveti ahAc'%obIige‘

A A A Mthctnfiélvcs and their poficrit:ieAs for fiver to their _h¢reditarieA

Kings, their heirs and pqflcrities for me: :% And ('0, Amaywig

A ,AA VI av A,

ed    

A fofeciQ¢dV"~OAatAh emu“: AisAA“   A

‘:*,w7t!**¢saz*:Iar¢d,A%%=§eAz«av1AA4» “ [397 A

 

A ghc ASrAatute3Aof 2+;  c. T2 2;; A26  r.. 23; A,a8AAA::AH;     A

AA35§.;%H,A8.%c.A1. :-A1 Eliz.A.c_. 1.; A3. ,.5sEliz. c. na§.}ac.;§:.;1. AA  
5, 4.; 7 ]ac.AAc.~6A. % 7' A M    A 

I  A 6Iy...AAA.A§ccaufc~A th}:prefidentoftheiRefilalnim,%{§vAhg1ij;:am«..

AA I:,hcAAcpmmAanAAdA A AAA%Aof1:AhciArA FathAerAwA%Ionad4bAAtwz¢ {can {of Re_mbab,A-%
' trim: ueitbzr; tbsp run their guns fnwzbet fiJnAnIu‘nrfztk‘a~~

Wine, nor build baufe, nor flm feed, nor plant, "mar bavemyvineu
yard, but%dwwel%!%i2zAtemsralltbeir days: 57 bald tbemfelrmbaund 

A Adm},  canfcz'ence {1o* *0bé7 Ai!.A~t Aw6i.cbfA C‘a‘~od,AbimfeAlf4 Acin2zz:1:e2zd£:,wArecAaArd:.«§A. A

;ArAcwarMd:,, for other: imitation, jcr. 35,!.AAcQAi.I?5.a who A migAbl““:.§?¥m‘
A big: fort oA5ligeA,Agb:VmA by bj.r*:0aftb andAAC*ovemAgztg)A [3 a convigmfiug
A    A A A A Ax=gt1me.nA¢,:-

A  5.-,;Becaufc'Iif‘t*hei‘ 9- 2A7,Aa33«3AI- AT.b%e%7'A.‘7Ienv: ordaiziediv and‘ 5V°°"L°Vm 

‘ -nan};

;l£A;:;*W1§“:;f2-kggument tb’atAAlasl*Ttl1ué * Wélrrantiex, Covefiazm, lAABéncl:;fCanI‘ra£?f;

Am Tihwm Fenfmgiw, Gmm, Ref§:rvatiamV'A9fRmt: ,“«$’ervic'ax,f1’:n;4lrc:?A2n fmi
.-angy, co Va... by thc Laws-lllb£AAEngland ,;-a,ndlm:hcrlNat1ons, Aifirmlylobligc

3

‘°”>Tcn“lS»“  Govenaats, Procefiationts, tdtheir. here dicaricé Kingagchc in
I-{airs and ;Su%c<:cfl'ors, obligcf them equally to thcmlin §?:AtpcAA~

:ui«Ly”and"{fluccc{'si0n.~  A 

‘An

A ’7lyA.l% Becaufi: ii: ‘is moi’: evidem‘ lbyhGm.l 3A.l~A=Il’4,A_IA5“.c.
4;-5;AExbAdu3‘lll 17, 2:9.   43.8%-A7. 1 .Ki72g:‘2.A z
King: “g“.: %27j.Ajer; 2    3'6; 31.‘ ~TAhatAA Parents by their ini-A-Av
quitics Aand Atranfgrgtélions may drawldown and Entaylthfi
curf:?8,thAc ~j“ud.gemc11ts*ofAGod on them, andL:theirPpficrlty¢3

_ ” Ohé i gal}-4, mans; lHéir:,A{ ~PafiemAyx ,"§Av)§fil"g~r71E£{.6‘7,. Afxecufart, v"Admizz'i_[ir4“1ar;,l
AA-»tI0n,Condiri- on1Ab;a;;b flde: in fuccejiiqn 4lndApAerpef;uitAy5%% SQ likewlfe thei;-AOlaths, —

aftér cm-:m J t:Aollclh%eAi~r “Jpre.j»udicx: ::A Therefore‘ they, Amayi Amuch .

more abligc chemlbyl their Oathsg, Covenants, ’;oQl3V€di¢flC€A'l.
Leyzal-ty”*”,=  ubjeétion vtolll hcr::edit:_ilry:§AaKingAg%AAAand 'ythAeiA1—'

Am p§0v_ z4A_ Hem; forI7=c”heAir oswn“particular;Aand:lthemf.P4AblicI{§bfid,:y@f6%Al

420.21. Rom. as ~wé‘ll as<vFrceAl1o.Id and A Copyholdll Tenlénts ;i.l'llAAlH0HC-A'F§_AA’m
1l3s,3- 4: 5; étmanorgmay Vabligcutl1emfeIvcs,their*Heirs and Succeffors lfWor%
ii ;“l:"1“I‘ 2;?’ evAer‘,«b*y:- I%Ion3agé,‘AFealcyr,f’IIem1res”,A ‘0_.i1l5l“aa8AC0Mtl.'l£lll Landi-
7 c ‘ ' 3' l'”1orc1s~, their vH€irA=A ~  A   A    ll sélr   
“ szamte-1aws,A“l  ch

no Sov"cAraign’Lords;and Kings over them. : A A 

A 8lAy., ;ArBe,_caulf&~~thc Salintrl and Churches afélod in all A Age: h'av¢

" tiAh¢mlEl¢E3‘and their lfictl-Amy bound in Duty and Con?

fcicince ta -P11]t%~G0df01‘A1belif€3fl:fe_91, prlfiaenilyof AtlaAéAilr»*Kiz2g:;

~ a?1dltbeirlSoAm and Royal ‘Poflériryyila all hercditai'yA Kingdolmsg,

   

D
Q
CL
E2
3
6'“
H
2
3;
Him

0

_u’gh they be %

agiaappzu:ent;liyAlEz%r4.; 6.. 1o, Q11. Pfizl. 712.‘: ,2, 1:3. A1_SanEi..A 

VA Am.A1Al4A.;l2ASan1. 16.*16;%1Kirlgs 1. 25;. l3A4,\‘39; 2 Kings int. AA12;.=

fa Ch1'pn.AA 23; 1:  :PfaI;l 149. 2; Ezcch.‘ 9f. 9. .ADanA.;, 2.: 4;”Ac.l3. 9, l 

 6. 6, 21.AlMaJt. 21.5. 9.]ohi1 12,13,l15.‘%11ATim. 2.1, 2; 3);.
A milVwche“‘anti:ént,lmodcrmALiturgyes, C0llcfl.'s* ,A. Létaqyesl ,

 the”-Chunehesaolfflzigland,ScozlmqbIreland,F,-me“, 
«SAPdi7li”,l“T”‘&,X1d5§L.‘l0IHfil‘A‘."l1C1'€d~itaI‘y§-IK.iHgdOIIlAS§5  he of ,

 ftmdr} FdllJ€1'!,€W71~Cil:, Hifiarian;-, landyolur‘ own Clauflsligjlls

A A Tmcfiz . A .. ~ ‘ A  V .  , 
3:?-La Nu... he oblige lt“l1emlf"cl‘2cI andthlc1«rMPoPw¢r1cy,»bySul<m'3n Oagbx,

Axgcivc. p. 9 5. Cownanuf wI‘l“£r0"t&fim’;0n£“. jta obey, proredi  and j def¢ncf’tbeir,AAlll%a;nd;

inAtbegTm2er,Al.n Cljf * AbAerequ‘o;ced.7 ThercforeA thefyniay lawfulg

6  their lpoflarinicsi 1i:p«al'.lPerAfim:, Cz:swmA ¢ndA 1ie>_ya{:ier;.  A  A A  ‘ 

'  lye T0?

Y A AA A  (793) 1: g A AA %%
  .A'g“iy.rTo put Liizs out 0? further queflion, Iflmil O’£‘fiy‘. 1pm'”~§ %
A mm Sc_1~4ipm_m-eprcfident and tcfiimonie?Tmora:,*Vwhercwith  %

  i;h.al1 _bm1cIu_deAithis'pmint:, «mid thac+ia*.th& H;ifl:orie *ofTt5h~§e AG'£- A

b’emzife_I,recorded_fo_[l;r+j9.4 €9%“”j‘v-W4.  2,~4~Sa;m.? mt1.;iAAA1§.’?fi..tcr§A>:I g;,$A 7

A ATheGibeoni1eA.s'(AaArc1imant%OftVh¢u4morite.s‘, withwhdmthéj‘
% Ifi2zelite:}by Gcpdscxprefa command were to mal;.‘c.:za peace not
*¢azre:z—anr, norfbew any mercy“ ta, but [mite with the edge of tI:e?fward'

and ubgteriydc[iro_y,ADcur;7.j45a2g '»3«c; 1m 1 %6:,.*'A.m;#5* :.  tirczme;
%%Vg;¢amiA§1gj%o“1§;ua»gfzd the «cZ:z';er_.ri;Mafi»ira&‘:1.~3}aj}fir%a'tag¢m,  ,a.’d,A_£2ot»n _‘

£13535 fl.2o aesj, b.;'e},z;J,% clazlm, mzd 3 ¢l_;;{,€r;g%Ari;2zfar1mIioAr2A ,A :~tTJ zzr '~A1bé‘)'°1f'{¢l??J%1é?i
 afarr, camztry ta analegr peace; mgd a iseague win’: mm; 7%} A veafzzfiz

:11}: glariazu m'E?orie:wGo%dVbmi%give:2 A,% and the mimclest be laazif A

awaugiaz for i'?.9fB73’Z‘5  tiJerez¢pan, tiwiibaut Mking am”-advice of God or ;
take Co22gregAaAtiw_2, Am‘ gxmining tbemtrutb of Ltbeir T£r:foArm4v;ion:,T }u-A»:
  fi*2%2.m a22dtba%EldeAr;.m“ft1:w: aCo22grqga:tia2:i%mtredivzrm;»IéagAu;2 *mi‘rI9A %
£f.;:41m gm M fi}$3‘i1 WWa Eitm [mam mm. mm mAtb$"r!am£ of
£?3A7;;‘E£%%%A,.§1»AAfik2fB. I£4"'izb2';2 ¢’%tf37‘¢"-° *dc:{3;wi" fl“"#__f£‘;‘T”:;"“:v£?“,‘@];;:‘%vgw ’f3.mrd 25¢}: A21':ez'r*: V
é2eigV}2b2%z%y‘5.camddweitAm1éo_g2gf£; zmm  &*»’?Z,£WJLj}«‘ came z4nto;i'}mir Ci rim

; ? :?)eA.t~,bi%r£i~~d.w1J»‘+] ’~"A1>’z.«.: the cbiidrazz ofA1fme1fmata war.-27 ma: ,, ’&1Ee¢ 5"“ EMS wcc 

;c.~:z&a,€a,&£r*§,?m A iflzinrcs 11? WA C:mmgai&Am»A;1A«imm!A Aflmgzm %A~untm*q”‘”“ %‘M‘”“&’

  

 rt:vc:?€:;2mr2v.xx‘1 

A 4

Aigfmi ;?;:jA»7:.~:3";*:’;?A;W¢*u" c{g¢:'2:;’é' tbs}: P,ri;z;ca::*.  Af;E?2:z.z: 4,¢*L“AA;;’3£'~ .’..W;ia‘2mA5   .A‘zm"w quEz:A firi*i“iatfl 

% '  A§l‘»fl%2jDj, ®;fiD9H§‘i‘éw£f?0$zAAal1'IbV3A‘C‘o?§gfc:gza+-n.maw:.<.=:ixfui:.-,' 

V _ 1:5?iT€7°§>mg;;~e;;:Aztfar; Wltaahahszfmagzuur$m%ii;£m;%hmmz;-»%L03nW§§3é1’4?,'~. 
A &iMM%f"§If1:¢a:2l%, tLbsr2fm2.B1be4+1nay”nmt%Entwtbmnl’A $1’/:i:%~bpa“‘°“‘ “ 'g‘°"‘

ms, m: dam

 

%  dojmra them,’ we 'w£l1”!e:“ !ber:2~Za“va!f lflfé mzazw fi¢t3%§3:a".;m W’;-V, g1;m.,W,w_.rfiAA.9
 m*.csm€::*.Mt§,m Blfzatb mat im mam m'z£t»uA£AAb2an4 iAnd‘:?bcdiaz1iar;ga.ai::,

.Ej"r£;v:w£ §?:;s'Ad mztp I}3.:*rm lat ‘%zb£*:n;li.v£ m‘; the“ Priflm13*z2d%?}7ra11iifedT“=’¢TY* fidvrm

_ '9' _  .  ,9: ‘ A  AA Wm, ~«* fi“*?A_  ‘N ‘.(’k .. “   A A ‘  3  . ‘- H‘A “A V” I  A‘ ““
€A*~*&m,;~ V534#i}¢’t;$fi1€fi3 19%;?  AAA§1A;AA¢fiwq‘ad%%Aand4%;draw;:Aar%: C‘?fij'WtI:I“’€75i%.!~;l7"%”M!t?b£~‘}?£::§:g§mS  

 cthzzgfegatiorzl   .A¥:id_.I;::¥IT1u?Wl!:'d fm~rbe~mand AMe~wn:a .‘t,.,bE77T |©fli¢fisJ W A

A fiay§2zg§WIJe%refoArAe f2a'U¢y&£;cg;¢iled m:,:faying T,T ’¥VeA are Aznéwfant. no.
f‘a:?M_}‘ai{, fmiaen you giwefl; ezmmgg my“ New fbaréforwe .:zAreA¥fcurj§d,j A M
and tbcrrvffmll 7m2f2eMvf»,va#j?%!M‘5r¢¢dfia'm beizzg bannim€’az,A‘fmnd bewer: 

 éfM‘wbad azrdjqyawrg jofwqrqrfiar Ibé1‘[l3461l‘[;€f afmy, Gad, ‘ A%V..4rzdA they  A
A ¢znf:vere_d A ]%‘§'3(-lhl-143 find ‘fi¥«i_£i:«&; ?.5€‘€4%Wfd3’ A iTtA%m;s ‘cevttainiy mild A [are  ~
’ 'mm5, haw the Lard tbx GM cammamded b&f3?'@flWI'M@f£$%?’0 give]

.3’0“¢WlAb€‘: Lands ¢«r%.ciA%rt2 déflroy WiLt.h¢r;~lfili.a&i!antx %»fwe~LaudA 5e~

A farejibté fberésfore we werejfare» afia£dAafou%rV4Iive1:=,becaufi:7%bAfyai4 5" A

    W if f%=*?=€t’v;:gé¢dMd%rigb£%W**¢ *1’? ’W’”’119 M: d¢»A‘V Amid

«::9?i?1%/’411’%¢ daAiié=1Bi: tbiflg-?f  find naW:«5¢'l2Aaldm:x1re.%[inA;1°bi2z¢”fmnfiQA

dz;

_AA,AchB3fl1O§A A Aycars afterAAiAca% viola!-.ion,and43 0 years after .its%fi1§Pc~ making) A
;hAA,,,,-_5, gma1,GoA%dfent 4 fammem tbelmzzd far zbr§eA~_year;,%y.e%ar afxe%ry%f£4rA:y:$m.~,;

Afwc.¢V Tcfla,

mymi, A nnoq

2513. z57,8A3.A
9..?'3fia~ ~

my avid snqm:ngar;»A~baA 

V J A   ‘ wrwqa;%_ » A  M
afidlie‘ un#a=tY7€5m,‘?»ancI delivered tbcmeumt A of 159 band c-‘sf. the Lcbildrm‘ :
’0fMrael,%1bat_tlJey: /law 1be.m* 22at.A»*v Andjofhlw made them that A
; day A¢bem%r.r 0ffw_aod;.,% and drawer!  wAdJ£”r% for Ilfiflcangregatian, . and 
far we ..Altar.VA‘o§ rbe L.a_rd% B13211 %tu;%t1)f‘aA BE??»V j imb‘e pinto which be A
fbazgld cbufr... _ AA Afzw this: :Oath and ;LeaguAc” ‘ the PrinAces4 and
Con4gregationA were ft)faprfromflayingorfuffering them a
A mA%b¢ flainbyatb€ir'Aencmiés"COntFaric: hereuncogtfi'&t when as
fixing: frion ¢;Aft:§r Acameup withca‘Il% ibe7irAAbofi: and e7:campedAagAainfi*.%%A~
‘ Gilmh, ta%dejmy iznhecaute may ban mane peacei1attb31'raal-3
1bAeGi£»eo22ite%jmding tbix meflage tafofhua G’ the cmpa:Gi1gaI;«A
to mwquickly @"Af4'cA;e 

Jlacknot %tb_y Aba7zd  tb_y;A fi[r72aI1t:;.,to¢came up
314?, fax alltbe King: of the Amar%iAte5..1batdtvelIinthe Mam2mim'A dre
gatf2ered7agair.fim.5 thereupon lcxfliua a72d4llItbe%Vm‘m.”of Wizrr
withbim went up fi-aAm Gilgal all Mzzig/Jr, and A came upwz their Em-¢

mic: fi:d£:2z{y_.,and fmate,é5“dcfir;ays*dtb£m ..;wir%bA a greatxlmzgbter, dc}. ;

livering thA€m_fi'0*mAthat~AV danger. A %A;7bou;t395;year%s4&1ftcr’this

FS:;)Icm% Auth 8: League; King%,SaL1Iiw out of btIr\2:ea-l to the children %

ofIfrac1£ndIudahA,faugIfit ta a'eflro_y all, and Jlew»fl2meof,tboje G1? )
* AbeoniteaApAafieri’{y,contany tar tbi: Oatbgmd %LezzgueV,for whiqhfg 5

al‘

  

A ax :>,!'»,‘

 
  

 

of the Ifrac-litazs ,*?bu:; Ofthit Armxrmrilz m‘ téw Amorices _-.. and

  tbezbi,1a;enMnfA31frael banA  uutntbrzm; A W-hemtlpon
MDM/id called tbe Gibeonites, and /‘laid uma Wm : What fhallal
doe for you» and inA!;.m1n.ttI) ib.afl.amakz the flttnncment,  

 ‘that. ye; mar!}5le_[]'e1FJe Inheritance of the Lord 3 And may {aid

 M }L1nt»o{the1K?ing~,”Tbe..mazz tbatconfumed 11:; anddezgifed agaimflm-A ..
A Afbtfijf we fliauldbe de¥firAAa_yedAfroAm remaining in any of tbecoaffr If»-V:

’ ra;eI,let fizwmzf bi: fan‘: be delizmed mzta Am,andFwe« willbzmg the-m&
sq! iizflibcvah  of Safuflfl which the Lard did cbujég which being“
% accordingly deg after that: God A ww» inIrea1edjfar%Atbe L;;md;I.

ant!Aremovcd’*1&heMmAin'a, 2 SiaAm«.;.2 14.: ;%.%co:45; 3* A A

V %Here%Wevh ave an A0;hth-Aand $:C«ovena»ntA bii1ding7tbcIfi“délite‘:~,
their Gpvxzrnours, Heirs and7‘:poflAAerityA"ixgA1pcrpetuixi¢Ato Atjhei-’
Gjbeom5te:%%and téhcirw pofleritibg wich {hall parallel with our”

fqrémcntioncd‘ Oath 95,; ProtAefl‘ati“on  caveman: to our Ahefree-r
A A A A A "   V ditarie?

A A A A A.  tfue*éiuj'cA there.
Aiofl?-’ The Lord.cmfwered‘bim,A IAc‘=was* few Sam], and forhis bloug V

dy houté, b2catife~tbepfleIn*tbe ®ibsznzAtt'ms, who wax.-e“noAa:¢

res)

ditafia Kings*;their4heirs and fud¢e1ToArs,Ato pi"bvé ’theni"mb‘i*e %
obligingico us:and%‘cmr pofiericiws, n%hamhi;s ‘Oatlx-& League A
,of(hefraelite; cd theGibeaniter,inr¢g ard cif%the£i:%¢vob1;'cryable :
circumflancc s 8: par%ti<_;uI.tu:s, nan hitherto‘ iAnfii’ced%% onfbyr any; 3

wh~ich‘I bcficch ‘Godin mc%rcic%w%%{et home ef:fi;(€’cu¢alIy %upo:tM1
Mgll¢our hqarts, fpirits, confciences, ibotzhfour uur informati-A

:09:-Efif0fm3tiC'3‘Da Afecclcament, and" avfliaiiitzg Gods‘aw:nging“

Qiufcice on us ;a]nd0ur §p0flerit:ies,%for Qua“ tmn£7é:end%cnt%pmu—

,_x:7ics5~~ 1“?bl“C.~'1ChV0f Q_Z£l‘.hx=::~3 and C0fivexzanc%sA~to our Soveraigne.

*1. This Oaeh zancl Cmrenanb with thve‘Gibaoni1;es %EmbaflZz-A-%

‘ V dots, % was p1jo.cure%d] by meerfmi1Ad, circumventiommifinfor:-‘

% macion,Vand“appar,entfiailhmod, ariéfing maéerly from tho{?: to“ A

4 whom it was rmdre and fwom:  Wt;it; obI;iged\thc Ifraelités

and 4chciVr»pofieritie, :t;iQ %ii:«he~VGilaeoniv¢:% and t%heir4%prug;:enieA "in
jperpaetumie zfl *Br1t%c%m.mmmentimn¢d Oazfivex, *togm;;her;;wi:h

 *“*th::é Pr«.‘;tm%%;atix_;v%z1,, m:a»;.i§ Aficalxxmnl;eagam<~a1na:§ £LT;,o»va‘I1;.ax;t,¢%%Were
~ made wi%;hm1t any  :3?m%:m%a%11v¢3zf;tEom mifinfmmmzion ,.

or Falfa  m§;z;a:»x1;.gg:"<m:<uds~M;Ioyaltie, d&1:cic,juflice,

M’--Veprudcnce, c§3rifiia,£1i£§ r:, ’B.éI.i§;i0n, andv%S%t.a-ta-gpolicie, valum  

4 7it3.Y‘ilypF'3’p{0l!lfldCK£‘ub)F mmrxxa hers, tankers of them, and ratia
<¥ fiéd in full Parliaments: A Ffhgrgfuré thcyflmufl? needs» b¢  farm

more valid , obligatory 7m the wholea kEng1i[h Nation mid

   mhcirfpofieriigies, than this%%0;ach,,w Covmant ti) the Gibeorziter.

 This ¢%1Lcague:,aud%%O4a4th% wasmadi::vcry*fadenIy,rafl1Iy,

“ ~unadv‘ifc%d%ly%, without any advice with Gcsdand the whole,-

‘“~@ongnegation,or examiqingwdcbating the truth ofthe Gi£zeaLa%

   

ynite: fuggcitiong yet it: bound%them:when%once trmde: But:
   wmm$»4a11¢m:aAde
;«e;na&‘ed;vcnioynedufion‘ Iczng and i5¢riousV;Adcbatc”; Amécm

deliberation in fisvcral fucceflive Parliaments: Thereibm

 

A__ours mufl be much niorc%~ob1iging than theirt. A   ~ A

‘V ~gIy. This L¢ague,OM:h, was made only by thugs‘ xinces qt’
VIfi~ac;vl,without tht: Congregaci*ons priv§mic5aflE"ntmradvice,
who "were %diflmntented with and ““m11rmi1redA44a,é!,ai%n4»{’t% {hem
fbrit,‘ yet: it obliged both the Princes; people; %anAd i[tsel1eir% P6»
: fierities : But: oui‘ Osatzhes, Protéflation , Leagxncand flute;

 Anantg, II were madenot: only by all out‘ Princes, N Obi?‘ s—,R.ers;

but1ikeWifebywthew'holc% %Hou fi: of C%omnfdns in ~fl:xIAlA 

Iia*mcnts, and aflenmd toiby the v1§hd1ewEnglifl1iNatiQx;bv0§h '
  ‘ » V '2  A m

we 5» E33. 
5'» X  C5!“ is’
§.z:A?2cm 9-,?»

As A.-ma%tificat*icm5ArBm;dur Ohmhésg P*rbwfieauif0d    A A AA AA A
z1a‘nt_.,AA Ahawe Abecn fwom A taken ‘ ‘again  A

A   cw)      
Asa 011A: of ,EP&rIi;an1em, the *Common5I being thg Aowrigimzl

7'*Lnmovcrs.%,‘A%p%'0n1otcm, mnimrivcrs of*a1I$ «or ‘111O‘fl“0FAch’ém)i:

AAA’EZh,m:;2§’me fiitfy mufi be .‘mx1c11%A%$z1:bmA7% 0bIiga£o:ie.to<;.is ‘anti cm-

VAmfiefixifis,AI:;hf§afi°‘fi1€§Ar$.  E I “

  A 4zy.AA  heazdLA«:agu*’,;0a¢1a,«}as%A%nmrracsfiea by a,,,,’4gpL;h,.
“ l3que,Law or decm;aofn1ie=wh0Ie Congregaticn and pcop3eA

pf Ifiaelin any publyiim Goxzwention, but cmly bylofbzm anti
= the?%Pr£¢nces‘aI+m1e3‘f‘ yet they;b%0sundAt‘i1%e whole Na‘ti0z1%%:7AA40%uifiaA

have been" ap‘A§)rov?edA ,; %1*acifi::d5. efbaibiifhied, A per%petA11atcd‘V by
  fu%ndryA«tPu_ccefiAivc A"A&s,A OF§iAi.D&flAC€SA§  V¢oAcc5»df;< P&r1Aiamem
% fx'mnAA me A to’ tiine 5% colnzinuing‘. “ fiili‘ in vtheir+fi1ll’1%egaI“
“ fcrsr"ee.A-f Therefommuc%ham”ore:va1id% and ‘Abinding: to am ami

«mgr pQ{%erities,*AthA%an tzheirsau ‘  A A AA _  A A
A r{1y;. Thac*O~ath,Le~ague;.,.Was~ takcziifworn only byFthieA~:*:
AAPr'incesthen1f‘¢1~7res,; um: by-uthe Ccnugregatziun-and pcc;p!a"~: 0fA

fraelgyet they wcre.A;all obliged by them; A0131! OatVh,3,%Pm'¢ 

t¢&é1;*i0.n,7League,Cmnanant, «Al1a«va‘ been {worn ,1“. taken not

A ;:on1%y,ATA%byAAAV%a1l opur Prizicezy;-ANAobI4es, OHicé;7s%%AQf% St:a?re,AIuiA’ci'cies, A

%4buAr.1ikcw2fie by all or mofiyof the CaA_znmonsg8£ peofplc owfthe

Land %fr<gArmA time Atotime, begth it; and cut of Parliament  ‘V
AA A ,Ther:cFore% A much, mom eabligixag to us; and’ Aozm AA,:AA¢A§g;hA_AmA %%

1 :3 V ;6Iy.A T%hiws4~atl1,L&£agz:ie oftheifs  the ”Gir’{$éVAw2z’ta—*I: 9’ Awam

  AAmvcr;gt.f1kcfn and curred in to for ought appeam, but: ance ,

yan;d (1h3!EAfQd€iDl,Y,Ag,j Awithout any fubfizquent. renovation or

TMAembc9rs'%of“' Parliament _, Officers af State, Aiufzices, Gm;

,duagcv:s, Latzvycrs-,~ M‘inifiers_., moi’: Seuldiers, and othAeAr3s;A¢

 upon fundny A emergent voAcca‘fionsA,? I both in and 0ut%of41?a1:¢J
Iiamem‘: :% Td1eArefm:eAAn3uAchA%more ObIigflCOTy‘.t0~‘lJ8&:flfid 

“’V;Afi:¢riAtie3;AtAh€n t~h€irAS%;AlA* A _ AA A A “   N

   ;A;jI’:[3isAVAO;1chj, League; 4. far A01: ght ‘wee ~m*ead,; was not

:mLadA7e‘e1masp1Ie*it1y?Ain~prccAi{g7a‘»Atern1sAwvit‘hthat Gi5eoa2i;%c5, their
.&«hs_.jir; and pcficritia’ for even“ A hm only injdefinitcljhwith the
,hGibAéronim* than in, being, A wbafe, lz‘jm.e:%:  tbs} fiaazfed , < as fihfl

A Awards import; yet bcqaufe they were a People; State
A vACA«jhie,AA;Body% MP0“-tickg)» having a permasnfint; ‘Afuccefliong ‘it vim

As $93113 Agncl; _ig1;£¢11tional1%yAAA,in,Jchcizg, pwnamd Gods acxzoutl

 Jmgtxc» AGOW 

(273

M% fipofi £273-m:«31%2t§r:d*‘x1otonlywtovni%1e%Gi&eani1a; :i1*¢nIwiAvi:zg, rm

, {&T§dns%,¢ man “chairs m.eh eGz'beoIziIe.¢%.% f

 Man»  QLIF3 are ‘m3€36,~fiV0Ffl Ourpwn %ChbiflianI
A m:tLn:~m1 Kmga, PIIRCES A, ASovera1gns, %of‘i'our. awn fielh , c;m,,“1,¢   :V 1

mm %z:hAeir fincceadimg%i1Tu'esin%S;mi;¢ cima, zxmt4.0m‘ years a;ft%er,,r

amt} ail[ut:ceedingGe:1cratiorm(m q perpem}zlZ\.T4tia%m1League: q 3 K.Airi“gs‘ 157.?

wfé f9AdoA,  BuI:m1fI: Oathg League; Cmrmam: ix: cfiérwt mrnsfi Ia-F003 4%
mum not cmly £0 our Kings to whom they were firli naadq I“fi"' °'“6'6,
‘m1d1"w0m,hut Iikewifaffl tbseiz: bgim,fuccmaw,anMKoyAa1 §'}f355f’£,:.,5c _'  
3P9W~'“?7”3 3~’-‘W-(I5¢4A1 74% I“ 3J7%#W=~4-A7 A,?W-‘5?jI 4EAli%+ Parl.'m24V-9&2
go. 1. 3. ) M Therefore they mufi needs4 be more binding 1:0 £13,4- 2- 5&6 Bf-

mgr VI~IeiV:‘5»VandATlPo&ariciea in pvmcmx and} fueceediug Gmem»~A 3‘ F5f3?* Tin {IV

.. % jCorp0ration,- I

" Abbie.‘ Coolw

_ 815:. Tiieir L_€$.g4(1€.',%% Oath, wagonly with fore'z'gn%%APziA- 11nm,.f‘3.94_
 gansa%Strangers,, who b:ecame%thm~ mere flaves:«andAAbond~%xm,15-o, '

men in perpetuitie, and h”adA not the“ leafi power, jus-A Gmfiflfi C16

La-i%f&iEtionovcr I.h€.‘m;~ yam: baundxhem to fh'i€l*Af abférvav 3”“ B"*'“5’A “T

x 2.c.zg.S<*:&.4.{
3’ :7. Sec-Magma

blond, Nation, to whom we are ‘natural borne Sub§c&s,Proioguc,amc£‘>

and mm ail duaifulf a1I\egiHa.nc:c_ by thfe?Laws of QT-ad ’, Cm-‘A H11’;

—‘ Nature» a:N&»ti0fl5 5 ; Therefore %muchA,V more obligingf to

AT and nieofi religioufly to in Kept by~:.zs andV:)i‘1rAA*poFrerities
~~a‘f7€rr'u8§      AA A  =  A   
 % 93y. ( Which is nmfi;=confi%dm*abEé 3% this their O:~;1tE‘:*?A,
Leaguef, was made with finch an idyolgwfoxis .rcmnam: ‘of
that ‘Ammanitesg, A at!  %:h%%imfeIf7byAitxprclk ,préCépts Ahad A .
A commanded“ Qtbe Ifrae1ite.c~%% to W125 :20 League _.,Aa2or {iovemnit A
witb_;.mpanA any mm;,_ but utterly to demo} with tbe edge of
we fword witham r21Werc‘ie , wirbom [wing any of them alive’,
"E~K0§~  :;:6*?iwre[‘“1WF’~ A”"T5A&,€J-AC-%j2A O1 A

 my  glrfia "aA3§;f1To6.<<34’ 4; not With’{’tandingA having

   

% ;d nce% entred. into a League wizb, andfwom to Azbem in the‘ 

name of me Lord, U142 they fbcmld live , (Achough by thfeiri A
%%;;m'n%‘Afr%au4d ,A Acimum~ventio%n, [find mi%finformatifli:m  God
;»*I§%uIa~;*é:.,AI‘;5fMA;ea?lous of hzlxwwzz name ,m bozzaur,g1ar_y,»foA gnwila M L M
 d1a*t hits awn‘: peopk ??"{hA0uIdAA perjurioufly , trcacAhég.A‘‘ “@574 M55»

,mufly;_., pmffidioufly break’ A:heirAé0arh%, Covenant morn 17’ ‘B’ Gm‘ M

. . 
in his namd, fr being; we-bigl2ef£,_1be mofl fizéred 'im:i9l4blé V0bIi-'g:fig¢'J"'° %
~gatia22.¢;A, iificurities 1114241 =c;4m% be %-be.me;e:ze ¢%God**andA mm, mm)
mad M14211; %4VNgtim and Ngzzimg ghgaghe would rather have’ hit
 Pafitiw

;-.{G,o,;u; d¢V*‘pofiti\?e ju'dicia1'I.aW,“( Aw;.hich f M fame cancewe «tofiowemizcig

Jurcbellixlm. condition in z't)violated and dif'pen%Fed;Within% this ca5'¢aL(%ig%

3 x3.#§-fl4-7- being ng>t fimplicevilinitsownI1at%ur¢4tO1part: the Giiaea;
:  ‘A mm upon their fubm‘Aifsi“on, buts onlie aprebibited ew‘f1;by
 particular Prcccpt,s)Athan%his N at_11_e prophancd ,, di{hozmVur-

ed, yflgeligious %%Oatl-13% wiminglie infringed. and p_erjur’ie A

  w4mmiW~’d%’bY hiiowfl 9wI>1s=-9  againfi Vhis*mora1LaW~;.Pr¢~
cept, being yltanfulm», %fc%and¥alous in; their own nature, axy1dV of

7 dangerous cont22quence.Tto%.a1I P‘o(ie;it,_ie, Aii‘.*a;dmitt::d,-aVp-

proved_§,to% encourage them to commit pcr}prie,a»nd,violateall

, Iawfull Oaths, Covenants,;in fuccecding: A*g»:=~s,% to the fizan-é
A deal o{‘Re1igion,»an5i prejudice ofMa;z3k$iz;¢j. A VVherc:’for¢ this
 ‘Oath,Leaguc,though a,s,';a5in[¥:__%g:%h$e{Ee iuzféicial Precaptsmot on-
.  firmly bound [the APrihces who maaie Mthrstn , WaindAaI1%the
Congregation~in  that Age,” but King Saul _=mrn£"éIf; anci,all
¢:he..Ifr4elite.: in fucctéflion fcur lwumdmfed yieasfs after. Uf%w!1’ich

we have another Prdlfidanlic of jfisafbuaeix and thelw [m.=?1ixe:A% cam VA

«to perform their Spies %()at:hs‘made m Rabab, anti f;‘im'.I3tt unm
;; 11811 by the fihtlztl, ta_fam{ber, bar Psamm,”  K'i.vzdred,‘ and 17 gmm
alive (though Cgznaqnire: dcvoncd 33;: God to ciefizrzlflixsn )
Iojb. A 2- 1,“ to_24.’compar'ed with. c. 64 21,, 22;, :23. I-;I_cb,  ;;§,,
 ,3 1. _B5ut:% our Qa£h$,%%Protcfla;io13V,Le;;;,a,ue , _%C0vma,;nt were
A an rihadefl not to,:or with % Anmite: or G‘an4a7zi!e.r parltivcularly
denoted by God to the Sword, Slaughter M and utter; extir-
_ pagion ‘withoutany Truce orALea;guc 0* Peace; but to and
with 0113:‘ own ~%herengyyN ;1awfu1l,"aChri'11im14 Kings, chc—:in

  .~He%irs,% Poflerities .;_f afid Suhceflfms , «whfe «P#Vr£0n~s,%VLiveAs,
. Crowns, Rights, and Royal Authmitie Weare allexprefly‘

obliged, commandedby God himfe.'11‘i; to defend, pro"eé‘z’ wijb M
. par cmulives, fortz2rzeJ;%efiam :‘otbe%uttern:ofi ofaur5Power:, a- %

   gainfi all" Artemm 3) Tfeafgm, .»Conf piracie 1", %'Tra_m r“.r,  and; I21-
% mfionl flvbatfinever .: yca paccifcly Vpmhibii’¢ec1*to rfier41,heIe4fE
fuiolemg  injury to1beirPt1;[an:,Li:zw_., m2d.«1°£;eg4l%Auborizy,i&n
1bgugbt‘,word§”.Qr deed, Prov. 24.. j2,~o_., 21 .Ecc§£-1'. 8=~‘2 c.,?1VC7J.

% :10. 1 .S'am‘L24.f3 ,.to_ 20.0; 26.8, 1:01 9 2~S»am.k1.I2&c.c.4.& IO,

% 1v«%1,‘A2:'s?an~é.18. 3. c: 21 17 Em:h_..2.. 2&;I%.,1~%2 23i c.6.2 %R.om%~1;si,‘

~29 3.. %1Pec. 2% .12, 13,417. Ilia.  ,1 Tim” 2 2.; 3.%_}ohn -

.18. 3 Therefbrgpun. O:aths: Lcague , _Covénant,  are
gxgch, more obhg1ng,and confcienciouflic%to be obfcrvgd

A 733* ‘us,A%~and our vPofieriAcies for(ever,? thafni theirs to the‘ GiI)ta‘— A 
nit::,~aAsthe only ntadygway toA%o‘m« P¢aceandAfettlement. A I "
I ~ % 1o‘ly.V,This%Leaguebf theirs co the %Gz'beonitAe: was%ratified»
 with one fingle Oaitb, % yet; it bound both them andtheir
%%PofiAerity’5w but Otlrs to*«our‘Kiug:, tbeir'Heir.r azzdSuccefl?9r:,A . l

is ratified with {Even .fucceflive Omatbg Prorefi2zt%ia7z:.,% CaverzzmtI,j AA
here rcci-ted , biéfidea fundfiy otherspf ‘likcrnature taken by  v
our » eflzzceflor-:; informer Ages, which Ipretcrmit. Therefore

. much§morcA firong,indifl‘oIub1e, obligin%g to 'us%~and o%urPo%-
'fl‘er_icies thantheirs. If a Atbreefvld card be not edfibI%%bro@*An, Ec,

glef. 4. 1 2; much Am"oArc*the%n dfez1enfald*0atb Fuccefi"w.veIy‘rc1iuet*“A‘
Cd 2 0101116? V1 10t' ‘€351? 01‘ quick1i%e’bc Abroken_‘., bptkremain in-

 A violabldtov all pofcerit-ie.L= H ‘

 A 11; 1The’=~violation A mi; Oath,,I".eague~to tbe‘Gz'bea:2z'1e:“
by Saul ,~ and‘rthe Ifr.aelite:~ near 400 years after its firflmaa
king , when perchance;;A_quicc forg0tten%by“thcm, or ‘conceit! 

V "veal to be unbindixjg to them as gottenby flxr;prife, as not
4 ‘made or taken by*tbemfe1vcs,~perfonaIi to the Gi£1e"bnite:‘aind I
T Ifwxelite:Lthcn.l=iving~whenAfirfi madé, or7ac‘*IcaA{’c e$:piAred%‘and ‘
A grown quite dutaofd’ateAby_fo l%dng~aAtra8c‘oftim‘e ;was re-

pudtea by Godhinafelf a grea~cjImte, perjitryin Arm, and'ex=einV- A
pl_arie%%puAA11ifl1ed by God with three years fizmine on*thé~

AAAvAvh»oIe‘La%nd, Wthough Saulvand _t:h¢ Iraelzimr %th“en l;iving‘never 
Amok this *O&th, n%or'd1ade that - Leagu e~“ zhe%m%felw”£3$”bu :1 onV1‘iek
  their*A%nceflors*, {'0 long time before their births. a Therea-

% with pha~nAds‘ liVff¢€1  H

fore our viol«ati‘ons' of theforecited Oaths,APr9tefiation5V$
Leagm, Covenant, fo frefhlic made, taken-1,fW»orPx, fubfcribcd
A A A»i%IV>en»,;A‘fuAcécA  =_e‘I“ie:0n»a‘aft§n;anAoA~%
ther,A‘by:A‘"wh‘4oIc *Parlia%mefi%ts;¢L%‘%VA%‘thé’ ”"ge?nt?raIicieA of our N a‘tion;»
and not onlie "by our dgceaféd Anceftorsgbut by *our felvfes

   

in-pAerfon,and~fo. oft reitera.tf:d,‘yet infringed by us'~wtim:Ac"aFccr

time in thc highefi d¢gAr¢c,4 muflnecdarbe a?mc¥§reAdefefiaVble

V ¢;1amnai:$le=%%P';§r’jurie,:Acnimméin the %~‘eyes?~m‘AfiV‘wGodAthan them,

anddraw a‘ tii%ora»“loi1g-eIa{£ing%famine; andbther forer iudgc- ”    
manta of GodA‘upon our"particsular Perwfons '*FamilAi<es% ;  3» V fl-~ jfiw 

 AA  A  a  _ aar ‘r“1
on, than that breach of their Oathatldleague  G12 pcmquc, d._-,%...A ~
fie*o7zite:,brO*ughtdbWnontzhem.   A *  A ;    A  m*!m<1uc.;Hc-a
A  <I*:e>ly. That Oath; , vlseague, “aéCFfi‘nt»inued~;i*n ‘Force itozbmdwi“9d°'U5:1lb¢I#I3
At}-1e% Ifm;-li1::~, . bm:h» tdoisigfervsetion and_puni.fl1menc, W; i  N
 “ A   A J “ V A A violated

 

 

 &?§:0‘YA”a tefi A by KAin‘g*VSa*s‘=:l and :he.m %,% '3fE€r'fl}fi,€' Whtfle fraaziw G15
their Government wa3$~quiwe c?1aI1ge&Af'ro.maAMnc.ipaIAAiAt5¢A::mI‘ A.
A':*Comm*on- wcéalth  as mm’: of A_cim';;Aprefent7GVrandc:”q:$wquld
-have it  imo  “a; King;bipgrzdwKiz2gdam,  thej evarmiV§cfETAunfi1a§:=-‘%
,RmusAdefire,s cohfcm ofafl the Elders Aqflfiwei, ti the .Agcncmm’
 33125! of the people, A anti,-by %Godfs%ownAappi*obazi0n,; as iwAsAAw 

»s*0*”:) A

AvidencbyAt'heA1%Sqrn. +c.”SA,to c.1;.4. ]ofl1.A9.2S4m;2m::ompaM—

"  rad togethfirg %Therefotfe% our Oath, iPra:mefiati0%n,% Lcagugg

f(3osf¢:::ant fr.:»rejci,m dg, mm’: by’;
. monai ob§‘Eg{e§azm*  s.r;:{1{’oIe ~Nat§on %inJ}prefc:itJ ,an ci% futu}:e_ 1:04 011:: %
r~4Ki:1gs,,”‘  d 1?e%ir%M Hairs % Aj and * ‘Succ%e{Tors , ~ A
AAAMEE vfiule11WcA-f01;c},bIe%iIIegaI ‘Alteraflons, Revolutions A,of.our

Iik¢ft*eadF-any Acarai%qi1wnc@,.mmch

G%ovemmef1ts’:' and Governoum ,}agai,r;fl.% the Vo;teaiof%%bot%h

v§A~§auf2m 0F”P'ar1iament‘, ,tAI1e“‘deAfiresA efche generaiiiy afom:

A  aizyme Nations, flame our-A Laws, admit rm Iiztewfegzmm g10rAA‘D_i€%-

:3 £€e‘ }:?EIfi?1a

>E:Aa.a1¢, Afln, A A

Title §l’1tIl.‘:fi-

.Qk3,¢uPm *"3§ae'W"'

tivcz. >,V

inmre perjuriou"a, finfullyamd exemflarily Vg.,vv.mi%fl1abE=.:+.,
” thktzps,‘  A - M     A A 5 . ,  
A , 1.3. This Gash, VL;-mgu-e with ts§1eA;AGiEAaoA¢2ize; =.va$"‘v:w§atcfl %

VA[c;§2i%in *0? the %Crmr:.; I€ing[bip,Ki.=zgdam, (a§%nhe~%S€a£u‘t£§;.Of

Prwrvmva Regr:.AxA” I aco£u';cb- 4 :.ACao1<:7IW«  W» A=mdiw1!a:v'

ILaw£1o0l{:\%%ArefoIve) A And (0 m0u%r -vy"Vi:‘0la“Ei:0‘mt$ ¢ th8§n»n1uAiib%e%
than A

:bjlT IiAin%gAAS;ml,3Aofl1y+ou%m%0fmeal%?«1o«x1%b¢Wdraasa %fxIAfi*a3lgEUt¥d;;ib;g

*  detefiabIe crime A,1 and b§e4.avengec§ with a

..%circumfl:arxc:es7AwhAiph might axtenzme itmras mofl

 (5irfi%iErcV1fi3$$ ) %ToIi%citadj him chereunw for Atheéir,   AA A A
«;a“x“f2ds- or advantsage :_ye_c this was no; fu ficiem: excuVi?sn.or.,§11ww.
«flifica3:ionA Atheraof inAGods c£’:e¢m% 3 being psmiflwd withex—- A
.emp1arie iuflicc on ; hfisv pfifficrity, and ,a Achme
A on a11 the,Land.” Therefore the vi0IatiQ¥1:0f%aII ourlprccciden-t

=ye.a rs {mains upv;

AOaths9 Protefiaétions, AC%0venams,% by the A rmy-Oificcrsg C0114»-

federace ~Members,' and «their Adherents ( A a{gaimf%i the Vote; A A

.;QfbOth'H0u{C£, the dehot:ta;t‘ions «ofour%%Miui&ers,a%nd% defirgé
of Your tzhree Awfiola ‘Kingdcams )Mmu{’: ncegla bx: %AaAfarmorc
mom heavy punifh-;A
;nem:Aboth_on them and us, ~r;h.an chearim Wa3%here%t0fom.% . .. 
A. ‘ 1I4;MA%Th%i;s= r_each offflach, %C0v€fl%wt, 2notwizh£?:»anddingaI‘IJ
V‘   1‘ AfX€mP13fY4
pmzilhgd,TAthoAughA_:;1ot on S;zz4lth$e chief %Ofl"endor%

in King David: R.eign,g3 5% yeamafter qhis Ofiencc commicw A
thc Awhole N ation by a threeAyca‘rs;fm12inVe;;,» I

  tbfiaaggbg

Anottvifl-1fiandi4ng an A

  dwinghifih
A-fife ,A %y¢AE upon fawn bf his.S9n3, and Family after Ahifideath ;,A AA

C*?:’l1?J*

mlmuglx in ms jncver i'nfi*lnged but only by lox‘1‘eA fi-I‘lg'Ie_'A&; 
 flayirag fame ofthe. Gibeozzitexlpofierity, and not re-violated
by any,mher«fu:b(eqlucnt flaughtex: ofthem. A Therforerchoughf
M‘ mmy of the grandgfl lnfringgrs ofthewprecedent »OaEh35-lAPfotg.. 
V fianioAz.;,Covenan;t,nmy ‘perchance flzape tfcotefrce far a‘i1:iAméAin
A chair gwn pg.-rfons,and.die without exemplary juflicelAinfli&ed l
4‘ (jf£'thAém_forA»it‘;:, ...ye1: 4 let them fromthisAmemorab1ePrcfidenn
.ccencludYeA1°0X1G%ercain,‘ that God willfooncror later ave*z3ge:AliA-ts
  gpon  ?(3'b‘ildren 4ndAPa§7¢ri:ytoAtl1eir~ueter‘extirpation,‘
A (and on the wlmle Nation too, as -he hathtdoz-1X;a in a great

meafixre &llj’6El.__‘€ly  itmzylbg 35jr?earsAaft%;artl1c‘Perjuries,

CIR-albnla,,lilcommitfedimzhis l<ind,Ae{peclfilly whennot coma »

jmirted$%only once, but perpctmted and’-aéled over fundryl

times by a concinuecmznintermgvtgd fuccetlion ofNewPeriu..«
ries—lr,AlTlrea.l'ons;,l;Vand“Violations mt thAemAin the hlghefildegree
{Pam day tcmdgy wlithout lfearAorAA;fl1am«e, as Ex<::>d,ll:go; 5, lcj3*4,

.7. Gen:.~3»14, I 5“. I AKi.ngs 2,.» 33. 2A éiizags 5. :2\7.jer. 22; 3'0; 

c.gl6.3 1..lfay A14 2021. MicI‘]I2Q:-’-t‘33j.4"SU jer.6.I5 .c.8.1z., may

V gfl'u”rc*AAa1Il%%oulr_ Alacéand prefent Delinquents in this Kind and

th:¢ilrA Pofiserieyl, %fWl*‘hicl1 tezxts tlmy may do Well molt fer-ioufly A

Aizolperulfiel, Vélitihr*bl€€dlflg;~aI1d'l‘fl1¢l1lZiI’1gl§;€3tllI5.a‘_  A A  A
AA A. 15. _ This their AviolszagionAAcA»fAzbcirLea3,;ueA,, Oatl1‘At0A‘“’lltli€‘
1 A Gibewmita; A was never openly jllllilfi€?Cl,pl&'aCl‘€d.,WI‘it€¢n;pzjgaQ_h5 A
H e“;d,prin;t.ed far, nr c%arpicd  wiltlrfalcmn17*‘ail‘slAan:d‘lHumi-e
_ l.iatie;:1sl,lA(,mofil‘*%dAete{lable unto God when thusabufed)

l  I  lg‘:      1' ~
A Af;;v£2rclly‘4punl§illaed bylAGodA~h1mfeslFon Sazllalpoflerity and

zicmyac falemnly abiured by new contrary Oaths m'AEngage-""‘ WY '53-am
nmems forcibly izrtzpofedl on all the Ifrcxclitely by=Scml Aand-his75* 8”’ ““* "Mi

:3,co 16,;;.(56a
;3.l’1'0§f-2I‘,'3«7=

W like Ifraelizex. A 0 than what foarer overflowiug,A~defolating A

judgements, may om‘ pcrjurious, Fidilragus Grandml.ASaim:,l

V Aflgfioflf, mofljufilie-fear and‘e:r~ipe& will A undou_bmllybcf‘all
M themll thezrpofieximes andoulrl dams, (Ar:2oWald!‘

 

 
 

  pbnadl»§»f®F;_d¢fl1*‘l’l&iOfl inAwi1EA-lmana apprchenlrbns)
whohavé not only inlfriugeda all our Oaths,Covenar4:m;,Pbo:l
tgllations, to our lawfull Kings, their llHeir«s,‘Slucaaflors,A and j
PA,oflerit:ie" aver  ojverTlin,chcl higheflsdegrce, A lbut mofrimpu-_
dflitly iuflificd, pleaded, hpl:CxlChed3. written, f'orltAh~elaWfi1“l
mfs thereof;  kcptmagieflypocrifical, Aeheillical A A

  

        . £32) ,      
A F[¢§f35and*"HflmiZi£1ia72:5 j to ?pfo1n%0cc% 011 I‘ moi} detc’fi_'abIa~  12'?’

A 1:ies,.'l"%reat:heri,es, Ab%,V0min%ations5% and publicklie abjn1Ared*&H4
E‘ forme;*J1%c)yaxl»Oat%h%s, 5 Procefiations, ? CVdovenants,% by] new

 Treafivnablé :e«Ii"fo%r_c¢d; %O%aths%an d; Engagements, d%iamecricaI¢- 7“

ly 1jc’:?p.ugn;a;nt ta them. A Ceraain1{ie%if this “ breach of Oath by

% Saul in flaAying%-thei C~}%ib“ea7rsit.{:: co%uJ:d»n0t %ba%eix?piated”9,-nor‘V

ighé  years; -amine: infliE?c'ed1on%:the‘%whoIe Landfrit,;remo-

‘ wed byall  D;aw'~d;¢ and: c?he;%*Ifr:zq‘ltm;Fafisg Prayers,'Ti=:ars5 %
Saérificesqagcillf this fin» ofthcirsWas~par£icuIarly bewailecg

I repenvted,~rem0vcd,% and full facisfaétion m;1d‘e*cd th¢_mur-

eh:-red ;Gi£=eanite:% b%y“D%a'm'd   pecvple, by.»Ade1ive4,fi ng 

(‘even of S.{m.l.r Sonnesfiiid%P0{ieritie%tobe hangedup before

A t.jhVf: Lord in Gibeab Q5330!-1% ,* far this pe::iu‘rie ar1”d blvbodfhéd "A

chommitztcd falongbcrbre by Sam! thbir Ance{’cor%, we prin-
” cipal MaIe{'a&or. % We may jufliie fear and conclude, that afl

our Aprayc-rs," .%t:e:aI:s,jV ”fa{7cs,,%- "humiliatiozas,  will * »nc~ver%4%¢5x;:iiate ‘

thé M manifold Mopez; %1 riAol’ationjs.1:%of‘thcfe our 0dtb.r_., %Prvftefldti-‘

"ans, AlLeague:_.; AA'Cawen;dnr:4, “by the mL1rd¢;rs_“of ,ourX1ate'King,.»

and mania that-uTands% ofour Proteflant Brethren o§“”a%I1 *éZ:;rts%,

for adhering to%him_.,.his chairs and po{’rcritie$ 5 the violacions
ofthe rig'hts,..priviléges of Parliament, beyond %allPrcfiden,tsA
of ii former A gas 5 fWaud% f¢¢curin,g.g  flaclimg   ’ l%~ersA~:
Houfe, and wMa}oz*itie of’th%e Cmmmons heretofore and ‘now
again, and trampling our fi.1n'damentaI L"aws,Liberties,Pro- A-
perties, *Remon!%rancea, ecl. aVrations,,;A%as well as Oaths qz.1ice;-
wu.nat?¢r%%foot,% by new%A".gfbitrAa.rie, %%T%y~ra%nicaI Atih, Impofitigxns, 
 pr9ccedings,%of%al1Ak‘inds, exceeding she wow: of our former.
Kings 5 % unlem.» all threfe pgrjuries, tr::acheri:**s,4 bmzches A05?
*0a,tht, A Protr:fla_ti<:ms , ('3ov4éz1amts inxhfis kind be particu- 

H-
O

 
  

R
5'3
23
7-?
:>
25
HQ
1''!
tr‘
3?
*5‘
3
:2.

A4, A , appeafé Gods wrath, and pre:fcrve%ourAwhoIe%

-19$s2~96-Gijxnerfally ixl;fa~moua%thr0ugh%0u£the AwomId.%that%%%FIE%‘-3‘ ANG-5
Mus ~mm‘fl LIACA3‘ is b%::c5me%. as Hprcwerbial AS jcFIDES‘P[;INICA,¢,

 1'4"! ‘  % form %

Zlaxrly ‘at-ldpublickly confcfiEd,?Vb::wayled,~ rcfbrmcd, vrcpencedqf A4
A A !_  If no texpiated%wi:3h theliltcjuflice and Execur;ip1rzAa upon the: 
:i§’v““;‘;‘;fi’:‘)*:‘ pnffonsg or Sons offoma %ofthe mofiit capital Delin*Vque”nts in

,,,_.iqui,,_ Ltfhrce K%ingado\m_es*from utter ruin;Vou1np¢riuries and braaohcs 
 cal, 'B1'imn;. Ufa}! Oachs,Fa1th,,Trufis, being nowfo %gencmaM<imv* and uni-- A

z A S:C1:ICA,_0rHYBERNIC3A5in f'oftrm‘.~A;ge9, ‘to qyur par-yr
crniaz, cm, pctual A.Which,i£c;hVis% »PubI1cati9§ mayA::-mire,  V

~5'form‘for the fa-turf»:  fl1a1l%Ab1e1’s” God fo:rT*it, ‘and ‘haveA mme
;-.»hQp€8 ofbetter tin1es~.-.thi§ags%,thc%n‘ yet we caxwzpoflibly expcflj

, whim: undar:%‘*the guiI&t,%tbrcach of F0 Vmany %%comtVz*a%%cii€’tory ‘
  Oac*hcs,* «Pr0t~ci’cations, Leagues, 4Cmrcnan’ts, Ing;a,g;ger:ze.xztés. A V
% ~By thcantienr. OachA*oVfFe41t_yand Afiegiancc, (7Whici*i% both

éthcSub§€L&s-mfE“ngla3zd:—and Kiflgrg~Bi[bop3,7Nab1£:, amd ;S'flb‘-A
je@,{ofVScotla72d5 made to the Kings of Emglasrd amiitheic.

g heirs,'as fuprcmcLords of' Sco!la%22d, in th:;fe%%wo:rc%§fi.)%% Era
mQfideli::*€’9'legalimfidemque @“ Iag4litatem%fferzx4,[2o, Hén%ri%c:L~. Eda .%
   wardo) Reg!‘ Anglzle,2CT5I§&l!BIIfbt15 ft1’ifi; dwitgd é?‘ memz9“rz2r,
  .;@' terreno banorc5*contm omne: quz‘ psjfu*;.:r~m)ére (Er motif: %Emtm-
~quam~pro aliquo porméo armmnecero in co2:*fi;11u vex auxilia comm
, deum z:el%‘1B2a:;t?2iJi2fi fans; in %aliqaa ‘cafizqui pa/fit cwmtingere, fed 4

A _Atmemem%um quad de eo'tem're cla%mi!a.;, Sic me ?DeAu.r mljavet £73“ 0211;: L L

fide1irer%recag:2ojEam, ez fidelirer fwciam fervzrixz gme pertinent %ad_,

ms S.am3'i‘oJ ajiun (‘WhichLO%ach%I Wfrlliam King; r*sf"5‘rm*:md I R085’ 
Hovurdcn, An;

A alll1is'Nobic;s4%fw<;re to King Henry ghee 2. Bf %i1§m7t13iJibLt‘x$ fun M pm P

ffiyficur ligfa Da’mz'm;fuo :-And 2AIo!m Batliblg 'Iobn(Co1n]n, 1:10,-3 A9545,
wwith”a:1:l+%%;ch& Naxblcs “VSco¢tIa72d=t%¢:3: mg Edward hand his 546   

‘bez‘r::Arm‘0’r293, rz9"4.‘,= M97.) they allin exwprcfs‘ tertnfs 2“'ThO-A 

A%:obI%'i;ze<:lAtl1en1feIve%s% %amd%ch¢-it %h%ei%rs,+'to% be true and faithfi-111 ¢

finghfilm" uni
i%Szzbje&t4a to the King am} his hair: :% Vvhich though valid, Vob- 3:

aligatorie in it:felt%ty0:%our Kings pofieritifig yetffom%ex_:f%_our Awcfm Ann.

Kihus in »th»ei%1r%1A%ife~tinms, m?adel~botI1~thé Scots“%‘and~ %Eng1i{hi’~‘93£xa94,%%»

vSub§e&s4c*fi takél ‘a’ Oath of Fealty and allegiance to N1 297-

 Athaiir heirapparent and his Ahefirs, [wing tbe«_featQ,, homage and

A  all %»his».,NmMesg 

«c Hovcden, p

»uI1’§41ai»@lit2s*~offj1S'c’citlwizd, Faazg §§t§;“f"=“*9%

allegiance done to tfmmfelzxex. ‘Thus: Wz'lliam% King Scot: with

   
  

 

,anti”Hh:§u5r24¥;etD'Kihg?Hé12r.;%j  aizd to Aflenwry his 7Fnn>,‘ “mad A

‘BM 112$!’ 3, u as to his Liege Lords, falvvafide ‘Damir2i‘1{egi: pa?

ml: fuio  Annoér17=;.Yca<»bafore‘thi$; AnnoI128.by’ the-~d Hovcdcu  :

A Wacoimmand 0f'King Henry f1:l‘me I;7 the~Ar<:bbifl1ops,B‘i{hopg,A""3l- Para 1

 David King ofScot.r, with Magi YthHEarIs ‘and ~ABaron*”'s gggcgfgggj
offingland, {wore homage %and%%fe,.z1t1¥%e‘;nMazgd his  d“aught’?eE‘ Durzelmcnfisg
and hem urfilhefuae Imyeratrici jFt‘B$.<;l'£fl3ata: Vre;;nuntA~JM12gIi.g Hifi. ml. 254.

ilaaeranitattn jute pafldie: fuss fibi Ethakztfibihufi tum '12g‘ttt'r Redwphus dc

brgv. Chronrl cc!: ;ea4. Chmnicon ]O,hah. Bromt¢m,col.%1oq6.=H¢nry dc Knyghmndc

W VfVVcfimin~t?te§;H4alinfl1¢d5EaX4t%:n,~Efibiimy Speed",-in-the lives; of WI.

Efv-"én%tjib1JS% Anglia: 1. 2; 9.9. Gui; LI C\§..Mg,,.a. 3p_§,3~?§,4a;.‘pa;;s, Mam
  ICPHCIK  

E?   me

Wflolinflyecyf,
v~o1;- 3- p-

é Aw:;‘o%%»~eae%n 
Animal. pars“
fwf.*¢‘i¢r»AAAv

' Edmrd%the 1

4'5-

 “ , K 34 A %
WE pgocrcatia ffitfiatfiflf mfi f2l2o’[)em viiilzk fexzli z';fifeR?.min 
L figyu;n_}a, gcmret . The pcrfidious violatidn ofwh3ehOath by
mam. mar‘ King Heizrieq dxeaxzh in crowning Sfepbm,
 *excmpIary%jud7geme=ms on

A tbé mf1~fuZ/ 'z2z'%o1arer;r therofi, and a biw-
» ‘ab’, .Along? lafliflg civil wdrrg

wizbin tbe bowel: oftba Realm between
A cflfaud, hcrfon Haénry, and the II«£i%i1rper~’Stepben, to the
Agreat %oppreޤon , deva_&ation,- d ibfation ~ot?%xhc*pub1iquiq,

3; peopiegas Aoaw Hi%florians ;7Db1'e1*vega»1l%£11e%gyo0dA
fqr Aby ,di£i nbcrii:ing A <.W!aud 3, ahd “ cmwninfg“: Stepbezz ~ capo-:1
their ‘own ;tcrms_.,’%;againfiE his oAwg;«Aa°rsA:dAw ehveiVrA(9ewbe:A.AAAA,% %bc%com' «-
wing void andAVnul1bY*33AAAis perfidiauj-}2efl:,throu—gh divix1c_]'uftim,,A
whirl) wi%ll%neve;r permit any gaod,%tbz'zz‘g: rofpring am affétc‘b.enozr»4
znom evil: as‘ perjury and treacbezyg which
 jud%gements%%%and %C}ivi%I wars, ¢ne_w-,r ceafing
,hE.'i1'_.‘I3M;f reflaredfta the Crown by :2
probable, {pcedy way now wand our pr:e1Ten.t*wars, Aoppreil
.fi.0I]F3'diI&FaL:ii0E$_-3‘ Military G%overn%m¢n c, and reflore pi:a'be,
and pfofperitia in our Nationsvé ‘After thi's,V.:An.;fI»AI 91- upon
theldejeflion ofmhc injfolcnr; Bifhop of El} ’
A geréntihip» under King Ricbard;,=the fi;rPc, e.A:;alI thfi
AEngl.=md affemhling together, fwore Faulty

still I-Ierzry the rigjlm:
friezzdiy agttemerzls the: only

A;7EngIazzd,. and to  all  The %Ci:ci:a‘eh$‘ ~'% A

Laxzdpbe {wore thcAlikeA Oath; %aVfié2£Ei».tI§ati

' if”King %Riclmrd% jbazéld
die witbom z'flE4e,Ae they would receive Ea

rl john bi: Ember for

t‘.b¢e:ir_ iliing am: 3iM3D%_.,% efijueraverunt :1’ _=lfin%a%1itatem»%co:2:ra aw =

gm: .hpmin e.r, flu-Ivad8»1¢iIat8%  RiChm:difrat%ri: fiti-: as Homes
In % ilaluf.
A . fonand heir apparent t:oK'ingHmry the third,
I and this mcmorable Writ; _ ‘
mud, to fummon all WIFOM above 12.1  yeam oi

A Fealty to him, as igem tn‘ tb£:3kifl‘g ,
A i:é_Ives —fai’chful1%y~A:o him as to-,thcirA

Hdeathk   V‘ A A  A;  AA A  A  
I A j’ RexVic.Eéaarum<:;faIutem 5 'Pr2e¢i'pimus tibi AAAquodA%inVfi-
dequa obis tcncrjs, -ct ficm; tf¢‘ipfum? A
A wezzircfagcias ad 1oca ccrt%a 8: adA‘di'c,s~c{2
fic:ri?pOtcvit, £D1nne£.,Iil;n§:ro3hQn1incs'débaIIivaV tTuaL gratis
 IA%V«w¢A**99§um fupcaeefifiwaéflmnfifi £92;fl31'f*§sUAt¥?¥‘;&!92fiA4A+¥ifiAIi

Liegé..ALordA after his

% bra ught H

ezheyqhciped ’

produccd fqxadfy A

:"ro¥m his Vice» %%
A NONE! of f
(O ¢RI'Cbd7’d K"Z'12g_o‘f '

      
iflhed to«aI 1£Ahe sAsm-itfisof   

aVnd> to” fubmit; thenw 

vet omrii~a€:uai;A d%Iig~i*s4  A
rtoaq ficémcammjodius A %

_ “I:*ta~qu%t§d hm. fiat formaiurgmxfinizi{i1i,~*fi5iIic*:@l: .-~ Quéd z’-pfi jab“
V%wv4Hamggio e1fid61i'74f9n0flra, fqua Nolazév mzwztur, A @ mi in win:
we wnoftra 22;¢!ZaA modaffenIW‘iare..vv1urg1zu, A jfimlea nritm ‘Ell!
Aiwfififlflfiififl M~TtWP3i1?‘0§ 9flifns‘ in quadfi dz NaI1$k%bum:$12itflS
.can:igafriAr5A 2inA2m tanquam bx1:A2ai.nalfitm%2tEnminn fun If?
gin stunt fiaxalitm: mt2nn2ntes:;% at sum pan £Dnmmn fun
,}li§i9~b&b2ute=s‘:, EzAAA:a1em~cim bar: exbi5msdi12gen:i4m,u: ins?
jde merim debeatin‘;c0mmezzdczri~.A A. Tefle mAeipFoapudVWeflm;A 124. V ‘-
» dAieii%%E‘ebm;%A Am r4.n~.».iL2 44' Eod¢méIn.o%d0_::Af?:rimtu4g ‘0mniblf1$ .
%W:c'e‘c7(:1t1t?itiiI:aq,us%.ra%-andsit appe2;rs~‘by'4’Dar "1  itihVey'vv’erfa7f'u%%xji1~% .
4m'om-d andfworn acconzlinglyar »iIn~£h”c~~P%arIiam¢«ncVofg   at A“. 
% 'i'bt. "Paris 11;:   P1 7; 1 The Lardr ;S7pi’rz‘t:,ml a nd‘ A Temporal f E“ *
-=*a,md;Ccimmo7z:,4 ‘were {worn = to %laeazr;f;zz?4‘b and} z%ruaa/Zegiance 10 ghg pgemrds 
PW-GA ifiiflfirm fb81@3iflW: 333 to his‘ time, am: to? wary in the Tower;
‘gum nf4%t)w*‘ finmwg Im2zra11y~A ftzccming tn ryamamu nip. gm; -sV2_7=-'

ifinglatw sand tbat? of “their” exam accord. } A%%A.Th-alike 5 ‘Oath was §.?§1é-53'

; -1!:akmrt0 the King51é’2tj_ee7z;«APrince Edwmrdj, A and‘V?che 19eit1££AA‘hfA* "3   1,;

the ihfttgfi may in the Parli.a%ment~of 38 mt: Par]; :1.  “ ~ A
.267» AAFH1 ‘$0.8 PT1'm‘e%EdWrzfA Son andheiir:’appareri$tt'o'K"i1ing   Th; 3;‘ J
.,.Ed'm’rd’the ;4~th%£fa%l!bAbf5 igztta, in the Pdrliamfizt of 1:7! E;4.§fm§;a:;4giP11a:2E

% g£'n'l:r&d.insthe;C1a1ufé Rdllof  E4. mg 4;, flarfo‘  %Yet;Vi~n cf Par1iam%en—%

point; ¢oi’I;.aw, C«R’onf"r:ie%nce, thefirfi mm %Of”%Fealt_y andfdli’-A’ WY 
lagz‘49nceta each pf chefe % IC;i72g:_ gb'zie %beir:%ézrzd?Aft{cc4e_-[]'arr, Qkobii-;.,{_,z% 1i_‘;9‘°8A 
ged %MaIl tha: .took Mchvemkaa fi:sm%11=y!‘i% ms  t1-?i*éAiit*%3i%bei«15*r’m;1«fiméf-e,_ §1g"HA7 3-; 
fir: , as their Hvmdge.rmAade by Jth*erriAto% thAefeKi‘AnWgs brother  A A “    A’ 1'7
Lardr5%j%_%(wh%ich Extend equallyw their heiéés, and »fl£m11not“AA   A4 ,
bebfeiterazed’, um‘ réneflifid to them upon this “ficggum;  ,
un1¢f8A         
~mk:A‘V"the:ms??bu‘r% t¥1@ih»eir%sé&rrAd4”€§d’{T?arit’i«é7 1*i1mvi%fé,»€[aIthVo4‘m’gh% 

‘ 3‘

3”
5
Fl‘

they zicv.%6rVt%oVoke‘thci?_c 0a¢&f;:mtlaémiElves;"Aat:*1.ca{f4~c«o a':'~eligz"~orm mAE[n{{ft_‘f,';;om3:,.
;q2‘2fi:ientiamAobfi:rwz'tian, xh?Wgh.not%>~totbe afiual legal p%En'¢2vltie:% x'o’4.5’A‘   u " A
fafAPc2:;#rJ 5A"as AngeimrAA:AdeA»GAlaWfi0A i‘n“Ir'»2s Siumma xA§ngetic'a,%ti:c; J  

* §';#namaz2fggm4:5A;- fc&,: 40» and mh cwV%@fiIHvAomifls difiinguifla; AV

~ di%a1AW’Ab€ifigA ~mAWde:—  t§¢fPu§1i§k;§Agqd,7MA fieéccg   

an%dw;che%famitveel §S,<.Inipttar"es %in’fa1bibI  Advém¢;nfi1~“aA1;¢ 3 
Am weKxngdmnamwarrfhfiredbyxt;¢,;;afic:¢, ~fDF€fialié’1.§fIfSV‘Qffi1IV¥
a1as,5s,I2rie.fc:4b¢;dfiywr Law¢s, Pamliamencm £Om‘h¢;-ffafflifla

@9L,{4r&1;;I¢5 .£'emleinen:g as ;well" ‘of ear, ,Ki_,

Ml

 

5 bridgcmenmf A

,~i 36¢‘ Augl
i?§§'2;Z3'r5fi, ms‘ f°n°~w '95"?W€?“‘9*’1A§b’°%ghf€4rg Vmenmv» barerofworzdgv
q L24 5. sum. gmran‘»preferm%em*,Végozcdxfpcnfed wuzh-byany srapal oW;,e:»,.
my Angelica, b;um4n%P#aw:rww§4tfi9vva.r %:;;mbc2%,ti %b‘majc‘.hz  ,1‘;  * ,*L¢;agu¢;,_%cg;
T‘ '7' 3'“’T‘""7"}e “ - Vt%f1;3!%§7B;€;8:"         ‘3S%E%:A 'd22d9,bi;gb;pm.
‘“*’“‘ “"“’“* pAbwz1a»m»e   _af%:be 4 mum, 1*  VL1LrsLEssEV¢r, .NA:w%: 

L3

9.

E“

 

 

V M ”‘  « “ M . ~ : ~  \ 9 u*'/  . V -- ' V ' ‘ .;. M
- «dams: Cfifomernmcnt, ‘A as ‘A of our K1~ngs»-and their;po‘fleri:i4e§

§f.‘3‘“;5££’§3;°“ AANDcoNsr’mQ7r OF e-onH1MsEw ,,  W114;  

Ecclef. ;G%%a11i_,** trarzfgrafiian of ‘bis, LLam mzd Gbfpel,“ d»¢j:Ierving4 the hwighcft tcms;
‘,7I§£?¢«1!b-%‘3- POMI and?~jE¢~cl¢fi»aij:1caIwcemurcs‘ In, t;h1s;WQrld,  as Well a3
*3» De dctema1% ;comd¢mng+£1on 1:;  x;he% world%rno: £0m¢,Eaecb,~%17_.

  ‘5» to 22.@-7er- 3+ Neb_s-- 12.13. »    

Achy-yrofiom% f 7-Whet her the »1EiA:f4“% illegal. 0aths,Ingagie§;xLe%n%ts vtdfhflé cw‘

%H0mi1. 17‘ in Q: T\8publica:z.rvafld% \:1’JO;re€?or54, enforcedonthe people againlf
1;4:t3&%%%Hom.9  ’(.3«onfcicr}_"<:es_, without‘ any lawful}, Pafliamtnaary
A A3: _ AA % “Aughur1ty5(%u{h1c}'x;saw cm: ilggaléy.m§~kc,prar:fcx"1be, 1m pofi: new
Bm,~d3.,'Theaj; OWJIA upmn the Na‘c1z>n,iafithe x—mrg:;nal K x$tazute:,re{c;:IveV,pa:fi

the of Gods ’?.3I1~-).d~i%~fpute~ -‘having  ; ycoht-vad51E§0r§c’A. Wmwtheir farmer‘
]l}dgcmen‘:s, l«&«WfUn' ~O[at;hs %%tmfoAmA[{1ngs, !:h£ix';Ha:ir5 :21{id‘iS.§:IC?c§{fifiQ;x"35%1j5*be

%- M‘«'- 1:3.   not abfwI%uteIy%v0id in czonflfzenjce %.,%y:e:ea. mere prop3=xaning’s+, A

%m‘;:’k:4f“ ,abuf7ss,%Vof%%Godafgc;:cd;%Nam:,g5 yam! ;M1fcais:c;\n om: of Afearw
  %%  A V‘ .‘_ AA _ » Na)bA1A%«‘wiz41ml1b* F max?! %;rSam=2; we
k%Ma. ,.,C.h¢ rcfi'.l“’L0nt°fla-y%V      "‘  ~ 

 mg 54; rad: ¢0.eu;b; W0; Hcroéézw 5 Wwitch  marmc/£1;v:AAr»%zala:ed than
Stanczif “the” obflerwd, in[£1ekeadI7zg%~30hfl The Balptlfi,  174. ‘£013.
E-f¢h¢9“é'1‘§5 I or chaff: few! Vow , who ‘mJw£d%‘jt’b£y would nei%t/Jar rm! mzr drink,

1

we¢:1Q2ef{E,%%na%%ma_ye5%$t;o lve%o=lafemed, rm m%ore.thar1‘3DdvidIf0atb, %

HA-3-0-*4-3 E kw-k.‘”M'1tbE§“b‘)‘fl& @lléd1?muI,,:A&;a re.  1.819-.Which firzfm3*0atb.r Vow; W K
"6' ""4°" 6E‘ we be A nb wayesm gbw 055f6M/¢*5}[bedding-winna;c'entA;b:£Md:.,,  A

1. ur a  ’ .. % . % % %  
.3¢::,?¢;E_5.4“5”;' the Falbéfri, Couficilia Cflfiofiiflia Cfifflifffafifld -5'caalmen_rcfo]vc‘,
a%4;jVE’.~f3,-j&:;A;§.“%* gsyoumay.rt:ad,aa1:largVeImVGrutmn Cauf.*22.que/t. 4,, 3umm4
13;!‘-I3 +%_5}?3t-.§'~ Angeliam, Tit. 2 juramentum, 1&6?-4%3%m4.s%:.%Pet¢r %Lombard, Sent;
3° E-3-¢°-":3: l,3.;diflin£i 29. gmofi ScboolmenAoAn 3h*ia%Text, j whofi: definitive

1530  3110‘ -I w " * ‘ "_  ‘m""‘ "" ' %, ‘ ..
M E_ g_ pa‘-.2'I)&rln.'3. 1; this A  Sit quw a_lz.cm Jurzwem comrafidm, cbarztm

R. 2»-c-5.4 H-4%-A c -10%;    5a..ac;.; 72 4%!»  c.T:._4. ,-_._ %H.L6.Ac. m. 18 131.6 A ~
4% 4-:1°- 30 H4 *5; ¢;-W-%.§~.%-3-%«% 3?3%7‘=<5-A; ;~6»'* 3-», 4 Sr 93- 4s.c;;:;;g. M %B;-,_%4- «Be In.‘ .

_8 }:«:.4. (2.2. 172.   C; 2,” 3.  %x%7%j_I£-A  an  R; ;3T.Mc;;. 6.;,1%9.  La 4. 1.;‘I-I;.I»»c. 8. 3 H-
8. c; 1.. 1  8: ’!I”5i 3. :1 ‘H28; ¢.w?‘:r:w 5,5, 3: fw“ 1;, 3! M“, 3;  c.3g. “ 2 g H. 8. c;
 2o.,.a 26 H.8-c;;zJ4;V%:%t%.*&7.;%%H- ‘L  H.8;fi; 3% %:q.[*@%2H;%. <2. 46%. 35  8.c.‘ 1r; 5
32.6. c. 9. V I%E1~i.z;#Im frgi A5    ;c.‘6%s;“fm?El i*h.i%~c:;§‘1%2%%.‘,y 4*; Elia... c. I 2. ,_1?]ac.c.’;%I?.
gjarc. c. 14, I5, ;  2.%6.,z1]ac. c.7.:io,2I. 'rhr:,P*ctirion of Right 3 C1517 came.‘

72 I C11’-.'C..l.' hr. c. 1. V um

 afficiumqxzad obferwlfi pe}are1mA zzergat zn4Aexi!um,<patiw=Aef?AA’%%

Imutandum ; qmm im*plendumA: Qgzferzimjic jam: vebemeriw peccal,

g;1m‘autemniutat b£fléf4cit : gzgi autem non%murataAd%_u;p1iciter per-A
941,5? iwflfitiquia waits jmtaintt , at quia Afacft quota nun W

mt. A1:1d:1 tbatTw}J£71a mombatbonce~ablzged»bimfieZf£a_yVaAlegal V « _
.4!/J to GadAA47zd bi: Saveraign,QA an}? latter 0atb're]7ugizantta,Vor;§g$?1fu’:}£:» 

. imazrfiflent with .2’! is ttml4wfz21,%1: Upon w;hid1' accouAnt our mmum ,._

m%Law6aol§5' aAnd. Lam r‘e171:‘IVe1,Atha.t When,%%€?vxi-:15 %any%Am:1hn fefi. 16-
fweargs %F¢al~cy4p,_AA:Aor doth Homage; ta his:LandIoa'd for thze %- G A.“ A
Lafids A held of him ,A-- in final}: by wiyh r:hiaA f;,3ecia%l%Aex;:eption,;  L alagirohfifi ,»
Eafijmjtbz jfaitb ivbicb3Ie»nA1n1ztn eutwilyomtbeahing ., whq C, 3 ,'Bra&on,,
is the-%AS0verfiignA%ALm”d of a.il i3isASAuAibje&s, A principally fworn f.%78:30~ Britg

unto, and to be A%oEeyed%‘ in tf)E'.firflApIace before all orany others. *0?!» l°- W0» A

Hereupon n;A%Walzer% Biflmp offixetgr, Ainrm 6» 1..for iiamic-  A

  Atingmthis C1aufeVout,0f¢ the I+I<:>n1a££?:w‘%hewreceivcdnofhis Te-Acmk, ha,-ta,

mints iriACarr2rvall, IN CONTEM%PTU:%M4% DOMINIR-EAGIS, f. 64 ‘ 65. spa. 
@“ admanzfe-jl:zn1},,qu%%o ad PR!AV:wlLEGI[Il\’.I WSILISVDOMINI '!W1ni~G301T1~

HEGIS EXHE-REDATIONEM,  DAMNUM (%1P»»F*"msP-g55»~
SIUS DOMIN1'B;EG1S A4dAvalemiam,%%DEGEM MIAIA.LErLIA~% 3:g:)g'l:S  %  

» BPuA:Rl1M”,«~heAhad%$judgemmc gi‘V_¢n..agaiflfl““hiI§'fl‘F01’.iE"Up*I‘nfii;g,%f,55a:R,  A

on an Information , andwas put: to aggxieat fine and ranfgme
fm Athishis"tmn<{‘cendVcI:1tloffence. A Upcm “this very ac;:0AuI1t A

A Hafifiore Bonbor Prior of Salon, an cmincm;ADAo&0r of 1:!-vze%C«a.~

non %Ia:w%,%% in his» Lmrbre; *dAe;:fT Bntta:' fl’m5,,%% %5A%q4,V §ViI. %%r¢{o1§m~AA, .
g)uftAof'oth;::rf oc9‘o%i*s%, That if tbe Kizzg move: war againfl my
Earonfif M4 Regime , bi: ‘femntsmzd HAom4ger:¢Aaranot b«om1d to
4,95]? Imn in  mars againfi the Ifirzgby tI.mi,rHoma%gAe. or‘I*7edlVt_y; Y
121%? ‘m”at}§:er,  AA  %?aga1i1z%s‘;f: F  
KéIN(”Ii'-4ISAASAOVAEAPMIGNA‘ ;oRADToTnamaoraaeinu
thasr Bfirmraae iefler power and ixiferiour Dwom:iniAo_p5,i: fwallowaA
ed up ar{'14‘;”%w7zcIe:1l9_y* the prefmce of %tI1e;&AI{ing; the greater zmdfiqae-A A

rior Igord-3%%«md1)n*caufi:1b;~Baron;%,%cammit: barb‘ Treaifcmaml. Peyrju-%

rye: againfi _ fiber King A‘,  wiblatfiwg¢V.bix Ham4’g°9,A%'%V;xin%% taking up
Arm: ’againji;;s ayjiwiaercupon A Abixq Temwkts are not baundgflta
agml» bim in%bAi:‘Periury -and Trmfan dgainfi b%i:A:S'azreraz'g9z%.?‘A ; And
oh; zomg; tor, Iflw~.h,€.df.¢tcrmin¢*s,:°‘—T]3d1if‘dAm¢172.58~:dSllbjflfi

V Am: tug; King: 3 A Srm-:A,1arci:ie:, which afrermrd:4wnga~ war :21’,

Eaifigti each; other 1194» 13: lzwnd ta fame Atlmxing , Svwfi; %CiA{y.im

.15’-M»AAA4i¢~ .   
A  A  fl1£?I1!,by.aII(Z§l_lr_}:m:_(':é:VV_l1 Laws rietofutlon.

Afisce Cdoks
_3‘Infiit. capM.I.%
A 474. Cantcrbug

   % __  " A
3:¢i::tbAav~19aam :;a~ wfaich FI‘P{}ST'ASWOTrN% Offlffifi,

 _.,Aj be%caufe his,%‘la’ttFen%Oaft%hAanti%Homage toL‘hi*‘3%Ia4PcjSa~V M

e weraign memo»: iréwallid ~‘f n'0r‘»‘” dijfibarget f.~;r;r4fi‘r_§‘z¥% Oath med Al/egizmcel
 10“bi.r A 013' ‘one.5,M;ieH£41dffeA g;h?en cam share»; IaiEer';A§Z’radj?2z:’;ablé0q;h;§;,
A AEngagq_m‘em:%Ato1aANéw A;Pmte£ior or” Republjclg‘, difp-I211 Ce wiuh
A ths:xfe;ant;eced.en I: A»lVeg.aI-»%Oa,Aths% , * Pm teflati*0n5 v ¢3oVaenarm .A:m

4.¢;0urAlamfuZ!V ICz'2-zg azzd bi:H;eir:,J1Vi;oroblige;u; imhg1c3fi 45.. A ‘
agrese v;ofight »~ag;=:in£’c -01’ ,0ppOfe.A'their'~.P8rflmJ5 %Tz’Ilé.r, 1§igfIm%A,

;»;~zoA ~ApAAerpwuate:r%Gun? w»a’r&'h»L miiérigs, "tflaxey Opprcfli on 55,” mag
Vfufiomg, and prevAe§,xfouArAfutu1*e:fctt1¢4r:16Iit-3    J 
A % £76‘ 1132 %%t;~hi;-:%refo;(*e\aVH..nc1w,feriomfly% ,emembe_rA, 6 _?n‘fifler“i'n

wzhe fear of Gad;,iThat as all who have been }'ua’geA:, ffm, A

‘ flficfifb kM:zim A, Bzgyliffl  Tewn.;_., V?VBarrefigns; Bezzcbcn, %Mim".-..
fljem‘ %Gra%dua‘tm; in ve:v*fiAn'e;r,: ~x5fttar!72e%y:,: C1'Am‘Al;ar ;ECcIéfiafif§-

pal C)¢flicerAs“*in%:% -a‘nyx.A;k:i11“d~A,;"‘ Mambers A  rb: Common:‘*Honfe, on

Tenantts t6?‘th¢Ki?x1g;befm?e ‘t.hcfy}eaVr I»A64§.h?ave;'mf£%%ucapkeA11.t%he
.;prem%i£¥:dOaths% ofM¢2é;m,.»Ia,rtsce:,1¥:ea1gv,Vor aft: iefi“dfSup4remacy
 211 Zegwizce  A Small.4ldermm5Gaz:Ver72am5¢.A]}aij1472!:,Liz/mi
-mm, Cammozz-Comzfirlemewz _., and—m.F7'ce5me:z% whati?gcvc*r wfcvchy
c3’ir_y.,4% A C£o:.rpom‘im _.,  S%ac2‘er_;g;A Campazm ;_E'mremz'r_y, .thmugh;-L-
.A;vmA‘1n  tin: «B.E aI%mc”,, A whavc ‘%1ik.cwifa~% %t,ak¢eI1 anc.v;.be:u 04!}: Abe».-
ainnin;;Achus~ , ~Taufim1l fwmr: iiamgonna\nn:Atrmmm:ttw¢

3Lieg :2.maAn ta nm;7»9<n1:era4ign V3LAnzh fAb£!»A‘]3f1TQ'5] mfiajgfiy, A
mm to am ifizirs ann®uccefl‘o;g. ,Which if ~c1A:jey‘Aw%i1i4AalAl .

AnowMconfci¢ncioufly% verific%and% rcfolultzely fiulfil ta the Right

 m'2dASuccefl2zriug?%,AAtA$mr;a(§growm,w: t?-my m a.fy.%foAcm putsfa -pefiadrwto A

,aAI;l« Vth;eir?prcfenVpfe]§r%Eow:§$7«‘I*axe3; ;M21a1riAae.;,;
A tilzflrafliéfixy %Fear%5, Dar2ger:5unAder t¥7ezr'Ne%wy17E"§z }'Pfid71““:Tdx9;

,Mafler:, and mm thcmfclves 4:-ealV_ENGLI.9H FH.EE--} A

 wk-VhamAan5f1  Wart ,  gr n1uMchAA~t?zwared forcin
inva fion,AA in fiend of,cc_:mtTim1ingAAs3vn$dflwe: underu ‘mi {hamed

 

fib1’¢_u,..g—han  lam  042,9 %, , f :31.1fl€'it-he!" 

,-3:5 Do(]m1‘v'Pu impofi:d,n0r adminifmd Wit%h0uI*c* d&nger,and7the guiicrbotli}:

Xfrte» jmiwhich mrzxw-ife men%.cam%% A.;ye‘1:M: »difcm:n  rmzlgaa; ‘
A ’ »   ;oAf-:;Fr&eedom c:r4AfS;ecz;xit_‘y ,4.bucin¢°yitable dcfoiation in; A
A ~th4epr%fi:\n»t..pmfiure0Af inf’; pmbliak ‘?aAffaiir«s', and zi n’ec¢1§ityA fie A
in.v‘oIvinAg-himAtTelf.in the gui1t:kof%7§{éwA Ogrlnwmiarc‘ }Au:eafo‘”n... A

0?f;;Perjm;y  i%‘€afa72 %tQ;th*3»1Ci7z"g, I{ingdam,V.wa11,d farmlidfh V

4 I fl1a1‘1‘cI@j”1’e;a%1>~I¢ ‘A '¢hia(emamb1*6 er[eafQn1abIe'“'w!mtrenw

~ AGan<m,B.cf01uti,on,andmAiza}be}na oFthe.4111- Cenncil oféw

.zm% in ,5'pain: Anna :6%8fr.A Aoam »a4s~an~ efi'c;&:uaI%Ameari&

k( thrmigh ,Gods% :blc[simng) Kw reclaim us from Ojuf ~for»méI=

P£Ifjl:!1‘ifi.5,\;.Tl3Ca,Chc1‘iE:5TgK¢§£C%id€SfvD3flOya1ties I26. dub lawful!‘

4 King amt %cheir% ¢Poflc%ritic,to4 %%rc.ffo1:¢% ,th%em 7to «their hem-

 ;iA£iin%¢7:Tran uility, E«Init:y,Tifade, H.+ozmumPr0fperi;y fo % V .  A

¢  fipfing expcéfedg defiked; ?l§Mu£tiIrum gentium‘%(utV frzmaefl‘: 563115 
if then principally in~l:cn°ded om: antiemél Britaim, Saxemr, 737, ,9;-e_ Ki A
J%Nar1bhm5erlanderI5, exceeding all other; Natizms in 39213111! James his
» mp, m:¢acbe1:p~tn, rebzlltons agaiuri annmurnets nfrbetr ggggy “f‘°Au%

A »§Bt't'tg$, {and noi%w%;«excc¢%dcdriérzhcrcin. hymns ofthis Age )%tant%a WW0 A A

»4¢i§ta4ri£ %.~?i~i%gh:;s,%dA1vert Gods hemfy Judgéztzerrts-{rum} Ii? 5 C0
~ £&ttle»wus‘;ir1%%fi%rnz,A‘ Iafling peace for the future, and refiorcwour

   
 

"1
PI’

4 , M“ cxtac Apctfidia aniam%orum,.utfiD£m%i4Ia£1famBt1tn.}J3Omi4 5 m§Giid;sde

J%aaKegibua* Iigxis ahfenham Acnntemnant , 1% nzwfimnlaflt excidio 3!
<~'F31ur_a1n2nI:tAp;nfer5iunem , ?num_ rztitwnt manta petfintxwgqyggf-$1
‘Simpwtatzm. Blumnt enimizizgtbus tut5;2t;fiyem, quam Cgmi,_  

  »=%€‘;‘1oi1‘¢txg§u4tu}:‘,% pgpefiartcantuz_:;. nccf‘rVn'::.-c:tc}uz_;g_:. viaolungen illuid c,,cmhm%%
 Jud:zcu<fé*1:”?pVér?quo‘d%induc1.cur malecIr&m,m:ultaque‘poe~ Spglmanni A

““‘A=mmdaciter. %Q;u2e ergb fpea talibus popuIis,cm1tra ho-— 395'  M““"“7‘7::
;:“flfl:es L1iborantca,.»erit?A Q_1_1xf:_fidcs ultracum %a1iinsAgem:ibu%s
A%“‘%in-pacc%cneg&mda.?* AA qutodi flfm*?‘du3 non Aviolandum e?qu9e*in ,5’ “M1,, 4

“‘~mru mi comminatio  fir pert A ens; r qluri A juram: in nV@m inc$% Dci Com.-il. IM95

b_u_x‘i dc: Gcfiiii
-» B.eg.I.%I.c.;.p

 
  

*‘?bofiib1us4%jurata fponfioi {’cabi»Iis permanebic, qflatmflVipfi!$Wcflm.Ann‘A A
5»‘Fpgnpgiis ifiingibus iuvatam ftmam n‘on:Im:1m”nt":* Qgis‘e~ 838.

“min: adeb fizriofias cfi,%qui ”ca%put~?fi1um manuwfuafpropria

E Fdefcces ? mi 1 %utn?aAm4m e” %)aimmdftn:dres‘fa1m:‘ib 

 pm  {eipfos inrcrimunt% .A in ~femtip_rnsffiofqqz
AA“ wages pzupgias cnnimrtcnnn fiirw.  E: cum dominusAA

“Fdicac , .No1icc uangcrfc»Chti‘flws mcos , 8c~David:*qu~i*siIi-A

W %qL1ita€x4:m‘det manumwfimm  Chrifizum D«0mivni; Q!

  ~~¢~censy erizmlidsro2c’?bttamrrtztuscw   

 

  1‘ '1

V "‘ M15 infmw. B)3i£5{fflm. Hoflibus quippq fidespafii datur,"né?c
W violatur.» ~Q;5._1c%)dAfiin belle fiadesvdleac, quantmrfiagisin A
“"' fuis "fcxgvarhda elf  fiactfififitfflflfqttixlpz £iE%Vfl1j:“!)fDl2£n%t
W a gantihtw ifizgum fungum vznmtua   fines  quta non» frjw
¢‘<»1Aumw2n§fi.§ rafltsraggfflaifié, §.s.n%2§t!fl W"m»**1‘*‘"’

.  }

   A ftm:noxntne% pa1ltc2fut%~%% tptau pgnmtlfio. lnde g&4,L.%A%;qmAo:&:::L
A “f:'iinul;:;a%reg%nz%terraru1?1jJ, %c2£:1eflis .iracu.n%dia i‘t5L%%%permz*J*tavim1,% 
:  ut proimpiétace fideimmdrtlmgaltemmfib ialtero folverew

“ °“tl1l‘~ Unde8c*A‘n%os;dm r.ere %opoi'tet,".%ca{i1n1hujufmodigem-

_ %“‘Vt%iU%m; héfimiliterplagaferiamur prmcipiti, ct%.poena4Apyu4f+

Wniamur czrudcfi... Si enim Deus.Angel-i3~in%!%%;fe praevari%can:-»

‘~‘Atibusjm:>n pepemi:,%qui4peringbcdimxiam caelcaehabicay  

'.i°%‘.€t11um perdidemnft  unde;8z,per  Efaiam dick: -.% \I72ebri.eztm‘»

A :“,‘glv4diu5ymeg; mcaela : ?qwufm;b%'%mag%is nos nof’:r2 faiutiia

 ‘~“in.tVeritum timere debernus%,n‘e per infidélitaltcm eodcm4?f;z*?51»:;:
cc *- A »_   w    .% ~ 
A A v1entevDEI glac}1o~~~pereamus.? @od,fid1vmam41racundI--%

":‘ amvitare;szolun1us, e‘2:.f:veri=tatet11 Ejcxs. ad clcmemiam pros» _
“  voc:a%r¢%‘cugxgnusg,,iErv¢wmm:;¢rga%“D%um .re%1igjon:sé--%»cuhum,

  Jeirque timorem 3 cuifnaiamus m:g"a.~3@3inet'pes j fli'4 jiTt‘I3:‘5  

  4"L*?1Ji’?l1icitan1%finsm“atqmz§rpnnfinnmn..ANan ht innobisz W3

  ‘l‘~~fi:bd0%12eA¢ perfidiagA 

  %%""ilv1 quibufdana }ge‘ncibu:,i%nfideIita{:is *f'u?btil1itaa irnpia: aim %
‘ » ¢ .iIII3'E'f13f,Ell'5fi ‘ltafafis at swim .;

‘ .
V» ‘ ‘ M»

4 Izationnm,uq£anna.me1tmtna.4» Ngua1~us~ apuavnos pr2e~

% A 5‘%fumptio'ne.regnum am" piat,pnu1Ius earcitet mutuas gfefiitioa 

~‘%‘ mes civiMi1fl1:°%l1£ m%O ms»nitetua:~inmttu$ regums fed, &c-

?“'fun&o in pace»Princ:ip.e,_Primatcsgentiscum facerc§0t.ibus% . ~
'~§$I,Chli,flm ¢jus)« OC?CeH~€J£em[R7egni ,fi..W Hw-_i0 cnmmunitnmz *? A
““iIfma§lf$ . 111: aum .univ;atis co?m:oi:1*diaA ’a..,nobis V1-c_l;ine:ur 5 

A 5"“ nuflgxm patrix gentifqur: diffidiumA, per vim atque ambih
A  ,c”uVm;z;oIia§"tur. I % Qrgbd;fiVhxcadmonivti0« memes nofiras
A%‘F‘,=i1on ;cgr£igi%%t5A%A%;¢tsa¢§i %c;on1:munem~~A:‘cAor4 nofimm; Ana»
;,_“;"' qmquimperducis, a»u%di~fe%ntant;iam nofiramgu %ic.t.m-
W-‘qua ergé .ex.nobis, vel mtiua I-I%i§'pani$«popu’lis, qualibea

_“‘; coniurationc vclvfiudio fiacramentum fiibzifux: quad 
Vwprc) patriae gen%t§’{q:.z..c% Giwtthtixrum 5fi*.atxr,%%f3;£1%_50m'E:tYJafifli18 “ "

“ ifiegige.falghimpallicitusea, te1n~2ta‘.o#m:itA.Vau%t ~a:iagent% 1113*‘

A‘‘? :2. atftectaimritAN aut%;a‘nifefia:::e imzgni ertmit 3 Aaut pgaaa ~ A

‘4femt_p;ionz my annficai rsgrii faiti‘giumufnrpab2rit .- fma-5 .

ffthériia1fitin%c;ompe€tLx D.~:¢i% Patris, £55Angei¢a~run1%[5_4V C.h*ri;-
“ 'Pci,eE Apoflalmrumejus, Spirims Sa‘An&iAA er M»arcyrL1m¢Chr1~

%‘:~‘%fl%i%,* V acgueab EccIcfia Gach01iC%?1Ai, filiuam petjmzia P39’ 
 :'~“% 1fl)flfi&§JB.tifi,{'cfliwziatupextraneusg 8:vA;;s;Ab<3‘nf2Vmi cmta;evCi1rij‘-

;%Af;€%*fiian.tirums alienizsa cm?hiE?usM¢~ieII1sii~¢:ati& {rm Vfflciwa A

‘fiquia opm:I;c%t,  utuna poem: mxcafi obnoxios ,"€q110sA%%{'fln"i-:==;»}.
F‘1is,errarA4ir£vcneric4 impIica1m;.r fQgod}iter'um , fegun.
‘%f,.g1a,etcéraio, rcplicamus ct acclamamus. contra ham %
¢‘Fngfiram dcafihitioncm px-ae£uxnp¢fl:ri.m:, Ai1athema,Marana~-

_% ¢FJ};ha;.;, hocefc, perditidifl xédwem{1Domini4fint,~A'¢t%cum
A it Jud; %Soarioth~ parccm habean: 31311 8: -focii fui; ct cum Die-‘ A

A Amen:

1

‘ffaboloct An eliq$e‘ ‘sA aetciaénis fuppliaiis con.demnax;mz'§
» g xu ,  %  ¢  ‘K   % 

:61 N I s:  

   

A  $»Any«m~4 mm». ""Pr::fident§rfi_  at cm; rem -pérAfona1;§‘nd   
~NationalV Judgements %infli&ed upon%pe1*fideous perfi " A

 

‘F;
J

jurious Infriugers of then‘ Oath: and%ACovemszm5 to tI=1e1r law+ a Sec Hlimtillg

[full ~Sa'&r:raign.r and their Heirs, b0th*'«1CABf1‘Ci;II1’==53Y1d{&bF0ad¢3‘;?’;£if;E§§

Form domefiiqucg   I hau‘epref¢nmd Him-,eden B Aug:
youjwich fume fi nal anew?» 1mbe%S'eca7zd Part of my Leg4%l andm1pa;5‘mP;1gg%

V Hifh;ricaI%VindicatzanoftbeFunddmeiztal.Lib?2rtic:,Vifigbtrg and y.%_ 44 9%. A

  ezc:> I to: 2:39 234. 23,6  258~. 2605 ‘%26 6,Vj£2679 3??’-‘V5 t0;pcriVaIHfrflory
V 3757; 333: “;_370oi3€f0r; thgflonquefi. Thrta Mm [f.mffdcnas»in the~l1fc.%,of
V fincc, ‘ymu may pe:;i1(2:&1n Henrzcz Huntznaozw fix, Hlfi. I. 8. giu Bwds \/Thea;

Law: of England, Lo7zdon.1655%.%%p. 29 12037, 44, M4554«7,b  *a m A
 5:;  6°» W "‘;:5_s~%7x9m39:;g¢ 8‘? 9??‘  9* 23* 3; '53’ améificuns
   I 02;! V        

_ %Rc>3»u!ph; ADI:

m9I$;19:a,,29 . Rage-ride I-Iaveden Armaliumpar: priar, p. 483. m %% 
Holinfbedy §a4..  p. 446. audiDo&ar,Bear4s '1’bmgv¢~fGvdr §2§2em3§?s,§
Judgement: , Book  ch. ::8;;I fhall7ini%anC»fl0tJ7 :mWiDfe* 1» ;*»4c-,¥§;r- #7?
mm*kablc%foreip%E$:.ample*s ofihiil‘ A A  ‘L   \ ~- '1‘ ,AIéf“““3 ‘MW!
%,% The Lfirfi is in A the ufurping climfyerour Kodufpbvgy Dukfi ofG;§§{;",§;{;;“ 1%
Sw_etbldnd.f Page: Hildabrimd,“ A antichg: ifianly Bxqummuuiv ,5_ ;_ L 4’ 

“ ‘ A   A F; “ “ A  catgixjzg  '4

Tfltfhg4Ei5;fi4A‘S0”VBPffi§An&AA -the Emperotxr {~1'mrycheAfourtb5 aAnd?AA
 Mng«Ahis;Smb;e&s»fizommhmA1A1%xa,nce to him,pmfwed

«~:h¢gEmApi;aeAAm9.%t%his aka ‘1tod1;Ip£2A':Awh%0fVrenwmbri ?g¢AhVia Oath

“ awfr A1:1%Aegmc¢ «tmth’ia¢.   pczrar, and howvile a

V. in? 
to: oVbey:““

   

.
ii

A A défendgvk.atA3~%;En£’p:refuf»bd .t:A;‘:1eAi iapcs f..yActAAafccr*-

  A beA«AfcarAAA*hfi mm Afia:m_;y4~ urjupnplzmt h;imAbe bddfivofm

 by. %;AthAajL:.yfop1%:yfl*ry:A Vamd%=*pmvfm:fin mfg AfamAeV4dBifl1'ops;A

he accepted and took %upVonA him :h«t,TitIe of Emperour_s,oppo- ~
fing his Liege Lord Hem)! in four feveral A»:»Batt%e1sfoughebe-A A
tween t;hem~ for the Emirta §n.»cAhe Iaffwhcreof being van-«AA

quifhed _., he _was~~f0r e wouxlded , arid 101’: his righthanda
VWhen he wasAr¢~adie«to die of his wounds, one brought his
;~i;gh;i: Hand Lquc~of£~inAtheB‘a_m:el umohim, AwhichAAhe behold?-~

ing with much rcgAret,iA<n de1:e{%»a:ion of his&Perjur-_y,an'd rg4.«

~ wbery chroughthe Pape_$AvioIence,%brake Forth imzo theft: -me-%
morabhe ,worde‘:%%in aha p1:_e_{;nc¢, of m.anAy4 Bifhbps _nw’hAo V had
perfwgzdéd I‘iAi?1'n%té§:: cAhi5Arcbe1%£ioz;;:5A4.  here the; A1;;'gbtAband

wberewiqtbI%f'dibré%4%faitI)7an»d afiegiarzcc to my Lieg£%WLaTrd 1}): VEmp:~A

for-HAcnry :tbi:‘wi1l”be an argument‘ of my bréacb affaitAb” before

GA9d,',. and ofyouf E“I?ayf£lZDU$i1flP.lflfl0fl%8t!D fihfifw fbemuflfl-AA:
‘tn.  Whichhaving uttered,  he in2mediaAtély  expired o?f Ah;is% A
woundsA:in4 a kinda ofAdcfpairing;A  nfcgr, ":13;  

%~Th*‘-‘AA‘f38WA memflf hit :APe.rjm3Ay A aancil =A   AbyAoWr1“ J“co:nf¢Fsi«onA;
AA   magrzztmqzwmzznda docmnerztum-Ada:rum%efi,A at mama cmtra DamAz'a;
A A is ,o%bcNcm nnmfuum canfurgflt_ '1‘{am‘AA * a5f€ifl}z» B11<101p%h”i%dexrer4 {Df9‘flifi"
 1‘-{by fundsjy fimamgsgarfufli1JmH?i£tfiMWm1m1lta§f.£wg «qui fia'¢mA Domim
A ayvfls : CODfl,i':~‘4fuAoA Regi juratam~-wi2o£;m:~eA tiamr,%Ae:mnqumAwm12¢V%¢mzmrA4 rum
.umum fuflfggfreflt, admgftem acc~e/13%; eti.am»%b1tjm memfiri f§rn;“4,_ utAA 
3 ‘ m Wcap“,.poeuam;a_guaf:¢r‘p1:u:Agt mlpa  as an-~AcHzfi»*arzanA oftgzar; age
%.,Wfi.MagnVi, obfervqs In thck lA1:fe~Aof  the 4.th.=*~  Len uéhofi

     
     
  
 
  

:‘i?3‘f‘“’l" with handa,;;fI&yd=4u114::che BiMe,Aa1~1d limd% up to

the    yet‘hawa_finaeA~£akem{, fubfEribedAwit@h

,  ',”§J& .‘ A‘  ,r1y‘,,fi'unM§
R  % A

;§-333*

contrary %therc;un:*m, R0‘;A.AEh¢A3A $,ru&:?is?e:§n.éfiem~A Kings-,,A
A V   A A A A @m«ahdy3;hsei*rA~~A?r1ma;:ei:.A;.7%Aaw1Ad .ane~_AA {fill
2 ~ ~     w&la.w£uAIl«H‘eir;

A A    “and

  
 
 

 

g.,.A.'I3i:. ‘ x;2A$%-Apgrfidimms, A1‘+myA-SaimLsA and AAAQ«l:hé:r. Gmndm Ahmtg.-A 
 4815A L°"8°"' %1£e¢r1A'»;< fubfcridbed 1:Ahe* A pmzedcmz A%A0~wbe:+ , s A} Prate§m~im,ALeag.ua :

 i t:h=n(A1AI:lt3-farm A  Aamsmslij  Ingag¢mmnm%  V

me SiieceififiitotheCrownr1;t:fi1’mfimberthiq ea prcfidéheA
 offiodfllpbwlth fear andetcmbhngu <  A A A   

g

A   To which If (hall;-annexe anotherefiaddceand njore tragi-A

A ea11spe&ac1a,Ane~meq be forgottfin  d’U;1adi/law: Ki’n’
“Hun sary, ehaveeingjmadae "a Ti1uAeeewitMheaeAAmi4ra!bA Athef.   

A k??ingeA Amuratb ] unproyided—t0$fight,~ gavehim ebattlefat Var;-%
fm! wi—theAeeaA:puifi'ante Amy _., %ar1d;was %liekely$etfo~tou;t«hinizga
  e~upon*[thc« fixfi; ¢nAc<::unte;r:v [Iepon which Aoccafion‘ Ameu-A

  a£:tAh;e;TAiJx;kesA)*AWhi7ch he fealed Aamzlfwore ~ etc):  2E_fi’cqe P3605
in eteh¢Anfie of“ : byeeAch'eecemma~nd of Eugé-:£,9m‘{3“sA°“"9
Am%im:,e and Aperfweflieeeof Aheis e.I.eg_at , M€ardAiAn.alAA~3‘u1e'42zA Aa;nd§ E',§fD;,2E fig“
A:o thcr, Prelaetea,-;;AWho aibfqived him Emmi this  ,3: Via;-.Fi:cderico A 3; 
1acedL -in  %mo’fi:A perfidiqux   mg7enner5e.AaAnd~ foot; after ca.;c.4. Knolls VA
A   Turkifh 1-1i—-  
“ If 1*)’: P- 397;
mbe "being in extream fear and danger , . beholding the
Cméifix  theedifplayed enfigns ofthe Chrifiians , pluck nf
the writivnegfout of ms bofizrme wherein the League was;
compr'ifi-A, and hcflding it in<:hie«handa wiche‘*hiseeye-acafl ‘
up to heaven , wufizd thefe words. M Behold than crucz'fie:d_

_Cbrifi, flfibia is tbe31yeagueA my abgiitiaufi in Army  aléjame e‘
  name mane amt Afinngn fa mrae5eeeAvt%f9i€i? J8! tbeJbavAe,AAA

wierbaut enycaufia :mmjApart, *via;laIed3  if tboulve (4 God, as
they fey thou art. and awe dream 5 1KBTJf'£!~I§E_tDé 1u’gnng
nn1nnne;us.nntuAtbp _=II—2ame an}: mes arm main my aeamee
upon tbpepe1:fur‘ieu5e 3@enp«le,1»A‘1n:nA Am  git Wests Anengee
fbnéjtn  "A; (15311; ; Upon the uttering "cxf which worcia,

“thee Banal Aprefently turned , ~Hm2iade:, tha.%t«v.aIiant General

and the Hmzgeriacm fled, the wb.eoleeArmy was “routed,
many choufainds oA£ e1:hemA%flain,an<;l;* Qlgem,frifenersgperjured.

AKiwng-e‘U£:ddiflnu&,~'~ A Cardirzalg,  I+§aviemhee_ moff 7PwelaAAm 

and‘NeBIe$ who perfwaded him“ to this breach of Faith  it;

“ in the ;fie§Id5e =tI-Le greatefl eeepartofefiungary ov‘<erru.n , gained,

andever fincev pofléfi”ed by,th;e ':Furks, ‘Z1delz'fl4A;as his hegxd eujt
effin rthe Betgel, A afemawasyfixed AOAM R01}: gaxriéd tharough
Gracie A avn.d% jdfiar in tmiumph , A and   xjghe Apeo_Tp1_c‘as g A

A monumentA.*c2fA God: il1f%iCe= A0111 b;iF.If1Vf0.I‘% ;hi51'E‘.“3flFYq  A 
‘ will not thy: blood of our beheaded King, the difinahfiritsinge

ofhis Heirend Suecceffor,1;he~ab'ju;'ation ofKing{hip it felt,-
8c‘th~eH:gu§'e%ef»Lord,;1:1};-::efi1bsre;£i:mA»of all  §.ighA:a, Fseew
A %_ A  A A 

figmga ”‘Ph[‘i.Vfl8gEB-‘ ‘of Parliament ,_ by “thofe In late ma pita»;

fem: «power, againfl: all the; 4%prem$i£5t*d Oaths, PratAeflaAtioxA1a,
& SAolcmnhLca@gue and Covenant :. A W%t?rAn by them iri tha name”
prefi=:nVcei% of God ’him{élf,' and the Ltjrd Jafus Chrifl,:wi¢.h
._AhaAnAd{G laid on thc‘“EvangAeli§§5$ "'andIif7tedup to H£av§nA,%¢and
f «thenfubfcribed fora perpetual Memorial; A cry aloud no God
A and” Chrii} for the }’iA’ke avenging ufl:iCeA fi‘0_mAH‘eavAe2l a-
Againfl the perjurieuz Infringcrs of t;hamW in a far'hAighe‘r deg;-cw

A~AthanA ‘vladislém was Aguilty cA>f_;, iFfpV1A*eAad%andAhe1d~up before‘
A “thmx by the‘difinheri;ted—~King and Lords}. No AdAOl§lbl:'Ail:.wiH g
 in ‘Gods due timegifnA%ot fp¢:%ediiy,reaIly anc1AdeepIy‘bewaiAI¢d A

vrepcnted of,‘by a plcxaarie ffitisfaxftidn and re{~tm::ion : Ant!
caufe Gad to  am ez/eiy man (and biz: %Pofieritj top  from

.. a:’Titus Liviusbzzr Hzmfe, % and ‘fram bi: labour, and empty him and bi: ofsall_pre-

Rhodiginus .%

3HiAT’t- M; 35 fem: lwimura and enjoymentg (as VN::£1em?abA fbalggd and

3”’ Camus empt:'cc{¢ his Alap,  that perfarmetb not Ihefi: Oaths, Pratafhztian“, »

Afimqun Lc&‘Leagz¢e, Com-mnt, t(A1~wbz'%cb%lJe44md%aI/the Congregation Abazxe

A1. :aIA.c.{ z5A.AA~ faid 21mm, NAch;A “=34 Am ,*r;«. ‘%‘ASince- Ache7eve,ryA Pagan Gm»
1A€Xa“d3‘-'l‘»- ab “ ciam, and   Rammzei iflfinuated as mush in the‘“‘*Cére*monies V
é‘:f1“‘;;‘;fr?1:n F’? of their T&credOath8,whercin fzhey p:ayed_.,T!mt ifthéy did A
A " “not faichfullyobferve them wxthout guile , that gjove and

.15 5. a 0:‘ “ ‘ A  ‘A _M
csrociwde “= tlwotber Godawould {mite and fl%aythem% as thcyymd the

jam Bgiii. A W lamb they then TacArifi¢€d” to    A, A A
la" me. x 3«- ‘'‘[b'%: cafl cut: and perifh‘ like the.fl0neft:hey‘threw% ou1:<:gf thcir
  A “hands WIA-mm:Ahcyfwore ; the B.Ac]igion of an Oacb,bcing

"A‘ for great among?! thevvexfy;Hea,thens, AAthAat they thought all

 

  %

“: human A Society aboIifl1edAt:Awit¥h fizs %vioIaciOn%  A ilndA thofé V

“perform imworthy to live orAAb"rea1-;Ah aniongfi men , who

A Vfldurfi prefume to infringe is: ,_ thoughpo theirloflc and

A A A A “pre'judicc. And fhaAll% they not .c0m;lemm uaqflhriflians,
‘f Mfifiifldflf and thofe mafi refined ,S’ai12t: ofA:t;hisAAgve_, A who1i=ke~thcA~AApere

?b'MA:°“‘“d'°fidi@us Atheificcal f ['artb4genian:,‘_['be1Ialonia22:,and4Pdrtbiam, A
‘A '7' “A ' 1°’ A regard neither Gad, nor%Altm,~,nor ‘Covenants, Il01"0I5tb5.a 720* V

A fm"tbAerAtbaAn‘tbeyferve theirmrnes to then: and circumvent men; to
whom profit in ~moAr_c facrcd than Faitb or am»? A No doubt.-A.

ilréy will. A  

Ezech. :7; A 181,419, go;  mzggbe.aefp;m»eoa4:a by
    J A   ~ Abreairéng

  A  rjw % V V      
vfimkging the CovemtLa»( wbenio.be bddgivgn bi: band )‘:m2¥

 5415’ W34” “We ‘?’5”$’3 b‘fl"’“”%”“ F~9f5'4P€%«‘ = AA Tikrefofre” tbui fizitb 
zbe%%%AL%ard GOD,   A:-1 live, furely mine ‘flatb that be bub de[pifi,=da,  

% W4 T W .,tCW”W“w V5557’ 5” 5”” 5’°1i”7*:% €097? it%..wil1I recamyence‘ 
f%'upan bi:%emn laced.“ % And 1 wilifpreadmy mt upoéz bim, :md bejbalz "\
 Mk?“ 3” mJ’+5'7W*v’ arr :@4?7d 1%Wi11 firingbimraABabi1on,avzdwil1~  

V plgqd‘ with ¢bim%tf5ere ,‘f‘or, bi: Trefpafi: that be Abatb trefpwfed g-. M  

.1 zairrfi me»  Arid  bi: Fflgifiwi, with aII%bi:Bmzd:;Im11f4zz:AA
 531« 1196 ]wiord{; and they tbtztrenzgzin {M11be%]2'atIeJr;edtewardmzlls»%
Winder; and 33»: f¥24lllQzo:v{,:t5;ztg.lVtb¢%LQRQ ];,.wg..[1~;gi;.

V‘  wrzr

    N’Iis1

. , -A -f‘-‘cl!’ "<“%3'.*“&-‘*"<~§w2‘n«~   ‘ ;a~4_~c{g;«::~ ~we-.Z.-*=y -   V~
   29.52% 

 Rm‘%«f-

  %x*647~ 15.1. 6&;unm¢a¢:on,r: W.» J %
%%%mric,;:ian.Vff+p.*18;l.:z.~Mec:ings, 2-. Algtinie:.A%4A. AA  A

A Mfargin; P. 23,1» 7, r.%S::anmzc;2zi.

M  #3 ’?’’;‘-'»*‘~”'v;;5g_-_~.:.~'ac*»~az-f*&=r)r:.' an  ;     3 '
v§’h'fiI‘€§%?T§.g€73‘~9€:4é"c:. "~ 9%'%€§f@ : : :-

f A<=«m¢%-«aw-~¢*2* «am» «*3» we Awzw ' - 

2 .

<-6”‘
‘?6§‘§
‘H
‘*2
5%

a 
‘T
E